EY659355

Overview
NameEY659355
Unique NameEY659355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length921
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659355 vs. ExPASy Swiss-Prot
Match: COTA_BACSU (Spore coat protein A OS=Bacillus subtilis GN=cotA PE=1 SV=4)

HSP 1 Score: 108.997 bits (271), Expect = 3.941e-23
Identity = 63/172 (36.63%), Postives = 92/172 (53.49%), Query Frame = 1
Query:   19 LPNGLRFIHVAADSAYLGRPVVTNETLLAPSEIADVVIDFSESKSDVAILANDAPYPYPSGDPVNDANGKVMKF-IIKKNHELDTWRVPEKLIKYPSPNPSSASRTRYIAMYEYTSDIDEPTHLFINGKSYEEPVTETPEAGTSEVWNVINLTEDNHPLHIHLGLFVVLDQR 531
            L NG  FI + +D   L R V  N   LAP+E  D++IDF+  + +  ILAN A      GD   + +  +M+F + K   + D  R P+ L  YPS         R + +     +   P  L +N K + +PVTETP+ GT+E+W++IN T   HP+H+HL  F VLD+R
Sbjct:  267 LDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGC---GGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPV-LLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRR 434          
The following BLAST results are available for this feature:
BLAST of EY659355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
COTA_BACSU3.941e-2336.63Spore coat protein A OS=Bacillus subtilis GN=cotA ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659355 ID=EY659355|Name=EY659355|organism=Citrus sinensis|type=EST|length=921bp
CCACGCGTCCGGATTTTTCTTCCCAACGGTCTGAGATTCATCCACGTGGC
AGCTGATTCAGCATACCTTGGAAGACCAGTAGTGACCAATGAGACCCTTC
TGGCCCCATCGGAAATTGCTGACGTGGTCATTGACTTTTCGGAATCAAAG
TCTGACGTTGCTATCCTAGCAAACGACGCACCGTATCCTTACCCATCAGG
TGACCCGGTCAATGATGCCAATGGTAAGGTGATGAAATTTATCATAAAGA
AAAATCACGAGCTTGACACGTGGCGCGTACCAGAGAAGTTGATAAAATAC
CCATCTCCTAATCCATCGAGTGCATCGAGGACACGTTACATTGCTATGTA
CGAGTACACAAGCGACATTGATGAGCCCACACATCTGTTCATCAATGGAA
AATCATACGAGGAACCCGTGACTGAAACACCCGAGGCTGGGACCAGTGAA
GTGTGGAATGTGATCAATCTAACGGAGGACAATCATCCATTACACATTCA
TCTGGGACTGTTTGTGGTGTTGGATCAGAGGGAGTTGGTGAAACTGGAAG
AGTTTAAAGCTTGTATGACAAATACAACGACGCTAGCAAGTGCCACATAA
GCAAGTATGCACGTGGCAAGAAACTAGAGGTGTCGGAACATGAGAAAGGG
GTGAAAGAACGTGTACAAGATGACGCCCAGATACGTGAACAAAATATTGG
TGAGGTTTTCTTACATACATTCTAATGCATCGNATCCGGTTGATCGGACC
GCCGAGCCTGGTTACGTGTATCCTTGCCAGGTTTTGGACACGAGGGACAT
GGGATGATGAGGCTCTGAAGTAATCCAGGGAGAAGTTTAAATAGTCTCTT
TATGCTCCCAAAACTTTTATGGAATAGAACGCTTATTTAATTTTATGGGA
TTTTTTTAAAATTGAAATTTA
back to top