EY659354

Overview
NameEY659354
Unique NameEY659354
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length899
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7472 contig Csv1_Contig7472:1..902. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659354 vs. ExPASy Swiss-Prot
Match: EXOC2_ARATH (Exocyst complex component 2 OS=Arabidopsis thaliana GN=SEC5A PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 8.606e-92
Identity = 179/297 (60.27%), Postives = 229/297 (77.10%), Query Frame = 1
Query:   16 SELAQNKSNKESQHLQNGYSSDPCTESLSDIPGSVVDPHQRLLIVISNIGYCKDELSSELYNKYKDIWLQSREKDQEGTDIQDLVMSFSGLEEKVLEQYTFAKANLIRTAATTFLLDSGVQWGAAPAVKGVRDVAVELLHTLVAVHAEVFAGAKPLLDKTLGILVEGLIDTFLSLFDENQSNNLKSLDANGFCQLMLELDYFETILNPYFTHDARESLKNLQGVLFGKATVSVAEAVKNXVIIADQTRGSEMHL---PMKDSKDDXIT**FDCSCTADSSKLLQQNLKRLD-HTACF 894
            ++L+Q+ S +++   +NGYS +   E  ++  GSV+DPH+RLL+V+SNIGYCKDEL+SELYNK+K  WLQSR+K+++ +D+QDL+MSFSGL EKVLE YTFAKANLIRTAAT +LLDSG+QWG+AP VKG+RD AVELLHTLVAVHAEVFAGAKPLLDK LG+L+EGLIDTFLS+ +EN+S++L+S+DANGFCQLM EL+YFET+L  YFT  A ESLK+LQG +   A  S++EAV+        TRGSE  +       S DD +     C     S++LLQQ L+R   +TACF
Sbjct:  753 ADLSQSTSRQDNW--KNGYSDEHQEEPSANTYGSVIDPHRRLLMVLSNIGYCKDELASELYNKFKYTWLQSRDKNEDSSDLQDLIMSFSGLGEKVLEHYTFAKANLIRTAATNYLLDSGIQWGSAPQVKGIRDAAVELLHTLVAVHAEVFAGAKPLLDKILGVLIEGLIDTFLSVVEENRSSDLRSIDANGFCQLMFELEYFETVLYSYFTSAATESLKSLQGTVLEIAIESISEAVETPGHNRRPTRGSEDTVSDDKQSVSADDLLALTKQC-----SNELLQQELERTRVNTACF 1042          
The following BLAST results are available for this feature:
BLAST of EY659354 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
EXOC2_ARATH8.606e-9260.27Exocyst complex component 2 OS=Arabidopsis thalian... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-C03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659354 ID=EY659354|Name=EY659354|organism=Citrus sinensis|type=EST|length=899bp
CCACGCGTCCGTGCAAGTGAGCTTGCCCAAAACAAATCAAACAAAGAAAG
TCAACATTTACAAAATGGATATTCTTCTGATCCATGCACAGAATCATTGT
CTGATATCCCTGGAAGTGTTGTTGATCCACACCAAAGACTGTTGATTGTA
ATAAGCAATATTGGGTATTGCAAAGATGAGCTTTCTTCTGAGCTATATAA
CAAATATAAAGATATCTGGCTTCAATCTAGGGAAAAAGATCAGGAGGGCA
CTGATATACAAGATCTAGTGATGTCTTTTTCTGGACTTGAAGAGAAGGTC
CTTGAGCAGTACACATTTGCAAAGGCAAACTTGATAAGAACAGCAGCCAC
TACATTTTTGTTGGATTCTGGTGTTCAATGGGGAGCGGCACCGGCAGTCA
AAGGTGTGCGTGATGTAGCTGTGGAATTATTGCACACACTGGTAGCCGTA
CATGCAGAGGTCTTTGCTGGTGCTAAGCCCCTCTTAGACAAGACACTTGG
CATTCTTGTGGAAGGTCTGATTGACACATTTCTTAGCCTGTTTGATGAAA
ACCAATCCAATAATCTTAAGTCACTTGATGCAAATGGTTTCTGCCAGCTC
ATGCTCGAGCTTGACTATTTTGAGACCATATTGAATCCATATTTCACACA
TGATGCTAGAGAGTCCTTGAAAAATTTGCAAGGGGTGCTATTTGGAAAAG
CCACTGTAAGTGTTGCTGAGGCTGTAAAGAATCANGTCATCATCGCCGAC
CAAACTCGTGGAAGTGAGATGCACTTGCCGATGAAAGACAGCAAGGATGA
CTGNATCACCTGATGATTTGATTGCTCTTGCACAGCAGATAGCTCAAAGT
TGCTTCAACAGAACTTGAAAAGACTCGATCATACAGCATGCTTCGGGAA
back to top