EY659350

Overview
NameEY659350
Unique NameEY659350
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12632 contig Csv1_Contig12632:598..1460. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_FLAAN (Glycine dehydrogenase [decarboxylating], mitochondrial OS=Flaveria anomala GN=GDCSP PE=3 SV=1)

HSP 1 Score: 458.759 bits (1179), Expect = 2.756e-129
Identity = 220/255 (86.27%), Postives = 237/255 (92.94%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK VPFTAAS+A EV+ AIPSGL RE+PYLT P+FN YHTEHELLRYI  LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWP+FA+IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH ARGDHHRNVCIIPVSAHGTNPA+AAMCGMKI++VGTD+KGNINIEELRKAAEAN++NLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  501 FKVFALGKPVPFTAASIAPEVQDAIPSGLVRETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPAFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTS 755          

HSP 2 Score: 25.7942 bits (55), Expect = 2.756e-129
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  755 SPGWIGADVC-----HLNLH 769          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP2_ARATH (Glycine dehydrogenase [decarboxylating] 2, mitochondrial OS=Arabidopsis thaliana GN=At4g33010 PE=1 SV=2)

HSP 1 Score: 457.988 bits (1177), Expect = 3.597e-129
Identity = 218/255 (85.49%), Postives = 235/255 (92.16%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK VPFTA SLA EV+ +IPS LTRESPYLT P+FN YHTEHELLRYIH LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWPSF +IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH +RGDHHRNVCIIPVSAHGTNPA+AAMCGMKI++VGTDAKGNINIEE+RKAAEAN+DNL+ LMVTYPSTHGVYEEGIDEIC IIH+NGGQVYMDGANMNA   LT+
Sbjct:  505 FKVFASGKPVPFTAESLAPEVQNSIPSSLTRESPYLTHPIFNMYHTEHELLRYIHKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFTDIHPFAPVEQAQGYQEMFENLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMSRGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDAKGNINIEEVRKAAEANKDNLAALMVTYPSTHGVYEEGIDEICNIIHENGGQVYMDGANMNAQVGLTS 759          

HSP 2 Score: 26.1794 bits (56), Expect = 3.597e-129
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  759 SPGFIGADVC-----HLNLH 773          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_SOLTU (Glycine dehydrogenase [decarboxylating], mitochondrial OS=Solanum tuberosum GN=GDCSP PE=2 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 7.992e-129
Identity = 219/255 (85.88%), Postives = 236/255 (92.55%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK VPFTA S+A+EVE  IPSGLTRE+P+LT  +FN YHTEHELLRY+H LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAP +QA GYQEMF++LG  LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH +RGDHHRNVCIIPVSAHGTNPA+AAMCGMKIV+VGTDAKGNINIEELRKAAEAN+DNL+ LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  502 FKVFALGKPVPFTAQSIAQEVENLIPSGLTRETPFLTHQIFNSYHTEHELLRYLHKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPTEQAAGYQEMFDDLGALLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMSRGDHHRNVCIIPVSAHGTNPASAAMCGMKIVAVGTDAKGNINIEELRKAAEANKDNLAALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTS 756          

HSP 2 Score: 26.1794 bits (56), Expect = 7.992e-129
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  756 SPGFIGADVC-----HLNLH 770          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSPA_FLAPR (Glycine dehydrogenase [decarboxylating] A, mitochondrial OS=Flaveria pringlei GN=GDCSPA PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 2.317e-128
Identity = 219/255 (85.88%), Postives = 236/255 (92.55%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK V FTAAS+A EV+ AIPSGL RE+PYLT P+FN YHTEHELLRYI  LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWP+FA+IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH ARGDHHRNVCIIPVSAHGTNPA+AAMCGMKI++VGTD+KGNINIEELRKAAEAN++NLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  504 FKVFALGKPVTFTAASIAPEVQDAIPSGLVRETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPAFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTS 758          

HSP 2 Score: 25.7942 bits (55), Expect = 2.317e-128
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  758 SPGWIGADVC-----HLNLH 772          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSPB_FLAPR (Glycine dehydrogenase [decarboxylating] B, mitochondrial OS=Flaveria pringlei GN=GDCSPB PE=3 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 2.317e-128
Identity = 219/255 (85.88%), Postives = 236/255 (92.55%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK V FTAAS+A EV+ AIPSGL RE+PYLT P+FN YHTEHELLRYI  LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWP+FA+IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH ARGDHHRNVCIIPVSAHGTNPA+AAMCGMKI++VGTD+KGNINIEELRKAAEAN++NLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  501 FKVFALGKPVTFTAASIAPEVQDAIPSGLVRETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPAFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMARGDHHRNVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTS 755          

HSP 2 Score: 25.7942 bits (55), Expect = 2.317e-128
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  755 SPGWIGADVC-----HLNLH 769          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP1_ARATH (Glycine dehydrogenase [decarboxylating] 1, mitochondrial OS=Arabidopsis thaliana GN=GDCSP PE=1 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 8.769e-128
Identity = 218/255 (85.49%), Postives = 231/255 (90.59%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK V FTA SLA E   AIPS LTRESPYLT P+FN YHTEHELLRYIH LQ+K+LSLCHSMIPLGSCTMKLNATTEMMPVTWPSF N+HPFAP +QAQGYQEMF NLGE LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH +RGDHHRNVCIIPVSAHGTNPA+AAMCGMKIV+VGTDAKGNINIEELR AAEAN+DNL+ LMVTYPSTHGVYEEGIDEIC IIH+NGGQVYMDGANMNA   LT+
Sbjct:  511 FEVFASGKPVQFTAESLAPEFNNAIPSSLTRESPYLTHPIFNMYHTEHELLRYIHKLQNKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFTNMHPFAPVEQAQGYQEMFTNLGELLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHMSRGDHHRNVCIIPVSAHGTNPASAAMCGMKIVAVGTDAKGNINIEELRNAAEANKDNLAALMVTYPSTHGVYEEGIDEICNIIHENGGQVYMDGANMNAQVGLTS 765          

HSP 2 Score: 26.1794 bits (56), Expect = 8.769e-128
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  765 SPGFIGADVC-----HLNLH 779          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_FLATR (Glycine dehydrogenase [decarboxylating], mitochondrial OS=Flaveria trinervia GN=GDCSPA PE=3 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 3.318e-127
Identity = 217/255 (85.10%), Postives = 235/255 (92.16%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FA GK V FTAAS+A EV+ AIPSGL RE+PYLT P+FN YHTEHELLRYI  LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWP+FA+IHPFAP +QAQGYQEMF NLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVI+AYH ARGDHHR VCIIPVSAHGTNPA+AAMCGMKI++VGTD+KGNINIEELRKAAEAN++NLS LMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  501 FKVFALGKPVTFTAASIAPEVQDAIPSGLVRETPYLTHPIFNMYHTEHELLRYISKLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPAFADIHPFAPTEQAQGYQEMFKNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIQAYHMARGDHHRKVCIIPVSAHGTNPASAAMCGMKIITVGTDSKGNINIEELRKAAEANKENLSALMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAQVGLTS 755          

HSP 2 Score: 25.7942 bits (55), Expect = 3.318e-127
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  755 SPGWIGADVC-----HLNLH 769          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_PEA (Glycine dehydrogenase [decarboxylating], mitochondrial OS=Pisum sativum GN=GDCSP PE=1 SV=1)

HSP 1 Score: 449.514 bits (1155), Expect = 1.638e-126
Identity = 215/255 (84.31%), Postives = 232/255 (90.98%), Query Frame = 2
Query:    5 FLLFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLTA 769
            F +FAGGK V FTAASLA E + AIPSGL RESPYLT P+FN Y TEHELLRYIH LQSK+LSLCHSMIPLGSCTMKLNATTEMMPVTWPSF ++HPFAP +QAQGYQEMFNNLG+ LCTITGFDSFSLQPNAGAAGEYAGLMVIRAYH +RGDHHRNVCIIP SAHGTNPA+AAM GMKIV++GTDAKGNINIEEL+KAAE ++DNLS  MVTYPSTHGVYEEGID+ICKIIHDNGGQVYMDGANMNA   LT+
Sbjct:  523 FKVFAGGKPVSFTAASLAPEFQNAIPSGLVRESPYLTHPIFNTYQTEHELLRYIHRLQSKDLSLCHSMIPLGSCTMKLNATTEMMPVTWPSFTDLHPFAPTEQAQGYQEMFNNLGDLLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHLSRGDHHRNVCIIPASAHGTNPASAAMVGMKIVTIGTDAKGNINIEELKKAAEKHKDNLSAFMVTYPSTHGVYEEGIDDICKIIHDNGGQVYMDGANMNAQVGLTS 777          

HSP 2 Score: 25.7942 bits (55), Expect = 1.638e-126
Identity = 12/20 (60.00%), Postives = 14/20 (70.00%), Query Frame = 1
Query:  766 SPGYIGADVCISSPQHLHSH 825
            SPG+IGADVC     HL+ H
Sbjct:  777 SPGWIGADVC-----HLNLH 791          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_SYNY3 (Glycine dehydrogenase [decarboxylating] OS=Synechocystis sp. (strain PCC 6803) GN=gcvP PE=3 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 7.527e-90
Identity = 158/247 (63.97%), Postives = 190/247 (76.92%), Query Frame = 2
Query:   11 LFAGGKSVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNA 751
            +FAG  ++PFT   L  EV+T+ P+ LTR+S YL D VFN+YH+E ELLRY+H L+SK+L+L  SMIPLGSCTMKLNAT EMMPVTWP F  IHPFAPA Q +GYQ +F  L  WL  ITGFD+ SLQPNAG+ GEYAGL VIR YH +RG+  RN+C+IP SAHGTNPA+A MCGM++V V  D +GNI++E+L   AE   D L+ LMVTYPSTHGV+E  I  IC I+H  GG+VYMDGANMNA
Sbjct:  459 VFAGKDNLPFTPEELWSEVKTSFPADLTRQSLYLQDAVFNQYHSETELLRYLHQLESKDLALNTSMIPLGSCTMKLNATAEMMPVTWPEFGKIHPFAPAGQTEGYQILFAQLEAWLGEITGFDAISLQPNAGSQGEYAGLQVIRQYHLSRGEEQRNICLIPESAHGTNPASAVMCGMQVVPVKCDGEGNIDVEDLTSKAEKYGDRLAALMVTYPSTHGVFEATIGTICDIVHRFGGEVYMDGANMNA 705          
BLAST of EY659350 vs. ExPASy Swiss-Prot
Match: GCSP_PHOPR (Glycine dehydrogenase [decarboxylating] OS=Photobacterium profundum GN=gcvP PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 4.879e-89
Identity = 152/254 (59.84%), Postives = 196/254 (77.17%), Query Frame = 2
Query:   11 LFAGGK--SVPFTAASLAEEVETAIPSGLTRESPYLTDPVFNKYHTEHELLRYIHLLQSKELSLCHSMIPLGSCTMKLNATTEMMPVTWPSFANIHPFAPADQAQGYQEMFNNLGEWLCTITGFDSFSLQPNAGAAGEYAGLMVIRAYHKARGDHHRNVCIIPVSAHGTNPATAAMCGMKIVSVGTDAKGNINIEELRKAAEANRDNLSTLMVTYPSTHGVYEEGIDEICKIIHDNGGQVYMDGANMNAXGRLT 766
            +F G K  +  FTA   A+E   AIP    R S YLT PVFN++H+E +++RY+  L++K+ SL H MIPLGSCTMKLNA  EM+P+TWP F ++HPFAPADQ +GYQE+ + L E LC++TG+D+FSLQPN+GA GEYAGL+ I+ YH+  GD HRNVC+IP SAHGTNPA+AAM  MK+V VG D KGN+++E+L+   E +RDNLS +M+TYPSTHGVYEE + E+C ++HD GGQVY+DGANMNA   LT
Sbjct:  439 IFTGNKLKASMFTADIAADEF-AAIPESCRRTSKYLTHPVFNEHHSETQMMRYMKKLENKDYSLTHGMIPLGSCTMKLNAAAEMIPITWPEFGSLHPFAPADQTKGYQELASKLSEMLCSVTGYDAFSLQPNSGAQGEYAGLIAIQRYHQHNGDSHRNVCLIPSSAHGTNPASAAMVSMKVVVVGCDEKGNVDVEDLKVKIEKHRDNLSCIMITYPSTHGVYEEAVREVCDLVHDAGGQVYLDGANMNAQVGLT 691          
The following BLAST results are available for this feature:
BLAST of EY659350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 368
Match NameE-valueIdentityDescription
GCSP_FLAAN2.756e-12986.27Glycine dehydrogenase [decarboxylating], mitochond... [more]
GCSP2_ARATH3.597e-12985.49Glycine dehydrogenase [decarboxylating] 2, mitocho... [more]
GCSP_SOLTU7.992e-12985.88Glycine dehydrogenase [decarboxylating], mitochond... [more]
GCSPA_FLAPR2.317e-12885.88Glycine dehydrogenase [decarboxylating] A, mitocho... [more]
GCSPB_FLAPR2.317e-12885.88Glycine dehydrogenase [decarboxylating] B, mitocho... [more]
GCSP1_ARATH8.769e-12885.49Glycine dehydrogenase [decarboxylating] 1, mitocho... [more]
GCSP_FLATR3.318e-12785.10Glycine dehydrogenase [decarboxylating], mitochond... [more]
GCSP_PEA1.638e-12684.31Glycine dehydrogenase [decarboxylating], mitochond... [more]
GCSP_SYNY37.527e-9063.97Glycine dehydrogenase [decarboxylating] OS=Synecho... [more]
GCSP_PHOPR4.879e-8959.84Glycine dehydrogenase [decarboxylating] OS=Photoba... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659350 ID=EY659350|Name=EY659350|organism=Citrus sinensis|type=EST|length=862bp
AGCTTTTCTACTTTTCGCCGGGGGCAAATCAGTTCCATTCACTGCTGCAT
CTCTGGCTGAAGAGGTTGAGACTGCAATTCCGTCTGGATTAACAAGGGAG
AGTCCGTATCTGACAGATCCTGTTTTTAACAAATACCACACAGAGCATGA
ATTGCTTAGATACATTCATCTGTTACAATCAAAGGAGCTCTCACTATGCC
ATAGTATGATTCCATTGGGATCTTGTACAATGAAATTGAATGCAACAACT
GAAATGATGCCAGTGACATGGCCTAGCTTTGCTAACATACACCCTTTTGC
CCCTGCTGACCAGGCTCAGGGTTATCAGGAAATGTTTAACAATCTGGGTG
AGTGGCTGTGTACCATTACTGGCTTTGACTCTTTCTCTTTGCAACCAAAT
GCTGGTGCAGCTGGTGAGTATGCTGGGCTCATGGTTATCCGCGCTTATCA
TAAGGCAAGAGGAGACCATCACCGCAATGTGTGCATTATACCCGTGTCAG
CCCATGGGACAAATCCTGCTACTGCTGCCATGTGTGGAATGAAGATTGTT
TCTGTTGGAACTGATGCCAAGGGTAACATCAACATTGAAGAGTTAAGGAA
GGCCGCAGAAGCTAATAGGGACAACCTATCAACCCTTATGGTAACGTACC
CTTCAACTCATGGAGTTTATGAAGAAGGTATTGATGAGATATGCAAGATA
ATTCACGATAATGGAGGTCAAGTATATATGGACGGGGCTAACATGAATGC
TCANGGTCGTCTGACAGCCCTGGNTACATTGGAGCTGATGTTTGCATCTC
ATCTCCACAACATTTGCATTCGCATGGAGTGGNTGTCCCTGTATGGGCCT
ATTGTGTGAAGA
back to top