EY659348

Overview
NameEY659348
Unique NameEY659348
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12425 contig Csv1_Contig12425:281..879. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_LACSA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Lactuca sativa GN=RBCS PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 2.050e-54
Identity = 94/119 (78.99%), Postives = 106/119 (89.08%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 357
            P  GLK  ETLSYLPPLSDEAL KEI YL+R+ WIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTD+ QV+KEVGE +KEYP++F+R+IGFDN RQVQCISF+ AKPPGV
Sbjct:   62 PPIGLKKYETLSYLPPLSDEALSKEIDYLIRNKWIPCLEFELEHGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDSAQVMKEVGECKKEYPNAFIRVIGFDNIRQVQCISFIVAKPPGV 180          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_PYRPY (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Pyrus pyrifolia GN=RBCS PE=2 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 3.064e-50
Identity = 88/118 (74.58%), Postives = 100/118 (84.75%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P  GLK  ETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:   65 PPLGLKKFETLSYLPPLSSESLAKEVDYLLRKNWVPCLEFELETGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_MALSP (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Malus sp. GN=RBCS PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.002e-50
Identity = 88/118 (74.58%), Postives = 100/118 (84.75%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P  GLK  ETLSYLPPLS E+L KE+ YLLR  W+PCLEFELE G+VYRE+H SPGYYDGRYWTMWKLPM+GCTD++QVLKE+ E +K YP SF+RIIGFDN RQVQCISF+A KP G
Sbjct:   65 PPLGLKKFETLSYLPPLSTESLAKEVDYLLRKNWVPCLEFELEHGFVYRENHRSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKAYPQSFIRIIGFDNVRQVQCISFIAYKPAG 182          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_GLYTA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Glycine tabacina GN=RBCS PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.164e-49
Identity = 87/117 (74.36%), Postives = 98/117 (83.76%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPP 351
            P +G K  ETLSYLP L D  L KE+ YLLR GWIPCLEFELE G+VYREHH SPGYYDGRYWTMWKLPM+GCTDA+QVLKE+ E +  YP++F+RIIGFDN RQVQCISF+A KPP
Sbjct:   60 PTTGKKKFETLSYLPDLDDAQLAKEVEYLLRKGWIPCLEFELEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDASQVLKELQEAKTAYPNAFIRIIGFDNVRQVQCISFIAYKPP 176          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_HORVU (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.594e-49
Identity = 86/118 (72.88%), Postives = 103/118 (87.29%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P  G+K  ETLSYLPPLS EALLK++ YL+RS W+PCLEF  + G+++REH++SPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VRIIGFDN RQVQC+SF+A KPPG
Sbjct:   51 PIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFS-KVGFIFREHNASPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRIIGFDNMRQVQCVSFIAFKPPG 167          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS2_WHEAT (Ribulose bisphosphate carboxylase small chain PW9, chloroplastic OS=Triticum aestivum PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 2.594e-49
Identity = 86/118 (72.88%), Postives = 103/118 (87.29%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P  G+K  ETLSYLPPLS EALLK++ YL+RS W+PCLEF  + G+V+REH+SSPGYYDGRYWTMWKLPM+GCTDATQVL EV EV+KEYP ++VR+IGFDN RQVQC+SF+A +PPG
Sbjct:   52 PIEGIKKFETLSYLPPLSTEALLKQVDYLIRSKWVPCLEFS-KVGFVFREHNSSPGYYDGRYWTMWKLPMFGCTDATQVLNEVEEVKKEYPDAYVRVIGFDNMRQVQCVSFIAFRPPG 168          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS3_SOLTU (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Solanum tuberosum GN=RBCS-3 PE=3 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 7.547e-49
Identity = 86/118 (72.88%), Postives = 99/118 (83.90%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P   +K  ETLSYLP LSDE LLKE+ YLL++GW+PCLEFE E G+VYRE+H SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP G
Sbjct:   63 PPINMKKYETLSYLPDLSDEQLLKEVEYLLKNGWVPCLEFETEHGFVYRENHKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEG 180          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS8_NICPL (Ribulose bisphosphate carboxylase small chain 8B, chloroplastic OS=Nicotiana plumbaginifolia GN=RBCS-8B PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 9.857e-49
Identity = 88/118 (74.58%), Postives = 97/118 (82.20%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPG 354
            P    K  ETLSYLP LS E LL EI YLL+SGW+PCLEFE E+G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP ++VRIIGFDN RQVQCISF+A KP G
Sbjct:   62 PPINKKKYETLSYLPDLSQEQLLSEIEYLLKSGWVPCLEFETERGFVYREHHHSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWVRIIGFDNVRQVQCISFIAYKPEG 179          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_CAPAN (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Capsicum annuum GN=RBCS PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.681e-48
Identity = 87/116 (75.00%), Postives = 96/116 (82.76%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKP 348
            P    K  ETLSYLP LSDE LLKEI YLL+ GW+PCLEFE E G+VYREHH SPGYYDGRYWTMWKLPM+GCTDATQVL EV E +K YP +++RIIGFDN RQVQCISF+A KP
Sbjct:   62 PPINKKKYETLSYLPDLSDEQLLKEIEYLLQKGWVPCLEFETEHGFVYREHHRSPGYYDGRYWTMWKLPMFGCTDATQVLNEVQEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKP 177          
BLAST of EY659348 vs. ExPASy Swiss-Prot
Match: RBS_BETVE (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Betula verrucosa GN=RBCS1 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.681e-48
Identity = 88/119 (73.95%), Postives = 99/119 (83.19%), Query Frame = 1
Query:    1 PASGLKNLETLSYLPPLSDEALLKEISYLLRSGWIPCLEFELEKGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFDNKRQVQCISFLAAKPPGV 357
            P  GLK  ETLSYLPPLS E L KE+ YLLR   IPCLEFELE G+VYREH+ SPGYYDGRYWTMWKLPM+GC D++QVLKE+ E +K YP +F+RIIGFDNKRQVQ ISF+A KPPGV
Sbjct:   64 PPLGLKKFETLSYLPPLSSEQLAKEVDYLLRKNLIPCLEFELEHGFVYREHNRSPGYYDGRYWTMWKLPMFGCNDSSQVLKELEECKKAYPSAFIRIIGFDNKRQVQIISFIAYKPPGV 182          
The following BLAST results are available for this feature:
BLAST of EY659348 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 126
Match NameE-valueIdentityDescription
RBS_LACSA2.050e-5478.99Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_PYRPY3.064e-5074.58Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_MALSP4.002e-5074.58Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_GLYTA1.164e-4974.36Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_HORVU2.594e-4972.88Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS2_WHEAT2.594e-4972.88Ribulose bisphosphate carboxylase small chain PW9,... [more]
RBS3_SOLTU7.547e-4972.88Ribulose bisphosphate carboxylase small chain 3, c... [more]
RBS8_NICPL9.857e-4974.58Ribulose bisphosphate carboxylase small chain 8B, ... [more]
RBS_CAPAN1.681e-4875.00Ribulose bisphosphate carboxylase small chain, chl... [more]
RBS_BETVE1.681e-4873.95Ribulose bisphosphate carboxylase small chain, chl... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659348 ID=EY659348|Name=EY659348|organism=Citrus sinensis|type=EST|length=598bp
CCCGCGTCCGGCTTGAAGAATCTCGAGACTCTCTCATACCTCCCGCCACT
GTCCGATGAAGCTTTGCTCAAGGAAATCAGTTACCTTCTCCGCTCCGGCT
GGATTCCCTGCTTGGAATTCGAGTTGGAGAAAGGATGGGTGTACCGTGAG
CACCACAGCTCACCAGGATACTACGATGGACGCTACTGGACAATGTGGAA
GCTGCCCATGTATGGGTGCACAGATGCAACCCAGGTTTTGAAGGAGGTTG
GGGAGGTCCAGAAGGAATACCCACATTCATTCGTCCGAATTATCGGATTT
GACAACAAGCGTCAAGTGCAGTGCATCAGTTTCCTTGCTGCCAAGCCACC
AGGCGTCTAGGTTCCCAATTAAATTTGTGTAACCACCCATGCAATATTGT
TGATTATTATTATGTGTAACCCCCATAATGATCATTCGATCAATGGGGGT
TCGGTTTGCGTTTAATTTGTACTTAGGCTGCTGTTGCTGCTGCTCAAACT
TTTTTGGTTTTCTCCCCGACTTTGGCTTTTTTTTTTTATATATATTTTAA
TAATTGAATCCTTTGTTTTCAGTTTCATTAAAAAAAAAAAAAAAAAAA
back to top