EY659343

Overview
NameEY659343
Unique NameEY659343
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length923
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA1_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic OS=Larrea tridentata GN=RCA1 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.314e-82
Identity = 115/158 (72.78%), Postives = 131/158 (82.91%), Query Frame = 2
Query:  125 PLSFNGSGAATS-VPSSSFFGTSLNKVSSRIPPSKVPSASFKITA-EADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            PLS NGSGA  S VPS++FFG+SL K +++ P  K  S +FKI A E  E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKL VHITKNF+SLPNIK+ LIL IW GKGQG
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQG 170          

HSP 2 Score: 64.3142 bits (155), Expect = 4.314e-82
Identity = 31/39 (79.49%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DIIKKGKMC L INDLDAGAG M G   Y
Sbjct:  205 LIRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQY 243          

HSP 3 Score: 59.3066 bits (142), Expect = 4.314e-82
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  171 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 202          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA2_LARTR (Ribulose bisphosphate carboxylase/oxygenase activase 2, chloroplastic OS=Larrea tridentata GN=RCA2 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 4.319e-82
Identity = 115/158 (72.78%), Postives = 131/158 (82.91%), Query Frame = 2
Query:  125 PLSFNGSGAATS-VPSSSFFGTSLNKVSSRIPPSKVPSASFKITA-EADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            PLS NGSGA  S VPS++FFG+SL K +++ P  K  S +FKI A E  E++QT +D+WKGLAYD SDDQQDITRGKG VD+LFQAPM +GTHYAVMSSYDYISQGLR YNLDN +DG YIAPAFMDKL VHITKNF+SLPNIK+ LIL IW GKGQG
Sbjct:   15 PLSLNGSGARASLVPSTAFFGSSLKKSAAKFP--KASSGNFKIVAQEISEDQQTDKDKWKGLAYDISDDQQDITRGKGMVDTLFQAPMQSGTHYAVMSSYDYISQGLRQYNLDNNMDGFYIAPAFMDKLVVHITKNFLSLPNIKIPLILGIWGGKGQG 170          

HSP 2 Score: 64.3142 bits (155), Expect = 4.319e-82
Identity = 31/39 (79.49%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DIIKKGKMC L INDLDAGAG M G   Y
Sbjct:  205 LIRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQY 243          

HSP 3 Score: 59.3066 bits (142), Expect = 4.319e-82
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  171 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 202          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_MALDO (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Malus domestica GN=RCA PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.751e-81
Identity = 111/156 (71.15%), Postives = 128/156 (82.05%), Query Frame = 2
Query:  125 PLSFNGSGAATSVPSSSFFGTSLNKVSSRIPPSKVPSASFKITAEADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            P + NGS ++ SVPSS+F G+SL KV+SR   SKV S S +I A  DE+KQT +DRWKGLA+D SDDQQDITRGKG VDSLFQAP G+GTH+A+MSSY+YIS GLR YN DN +DG YIAPAFMDKL VHITKNFM+LPN+KV LIL IW GKGQG
Sbjct:   15 PPNLNGSSSSASVPSSTFLGSSLKKVNSRFTNSKVSSGSLRIVASVDEDKQTDKDRWKGLAFDTSDDQQDITRGKGKVDSLFQAPQGSGTHFAIMSSYEYISTGLRQYNFDNNMDGYYIAPAFMDKLVVHITKNFMTLPNMKVPLILGIWGGKGQG 170          

HSP 2 Score: 62.003 bits (149), Expect = 2.751e-81
Identity = 29/39 (74.36%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DII+KGKMC L INDLDAGAG + G   Y
Sbjct:  205 LIRQRYREAADIIRKGKMCALFINDLDAGAGRLGGTTQY 243          

HSP 3 Score: 54.299 bits (129), Expect = 2.751e-81
Identity = 26/32 (81.25%), Postives = 28/32 (87.50%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKM I+PIMMSAG+  S NAGEP
Sbjct:  171 KSFQCELVFAKMRISPIMMSAGELESGNAGEP 202          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_PHAVU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus vulgaris GN=RCA1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.282e-80
Identity = 112/159 (70.44%), Postives = 126/159 (79.25%), Query Frame = 2
Query:  128 LSFNGSGAATSVPSSSFFGTSLNKV-SSRIPPSKVPSASFKITA---EADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            L+ NGSG   S PSS+FFGTSL KV SSR+P SK+ S SFKI A   E +E +QT+ DRW+GLAYD SDDQQDITRGKG VDSLFQAPM  GTHYAV+SS+ Y+S GLR YN DN  DG YIAPAF+DKL VHI KNFM+LPNIKV LIL +W GKGQG
Sbjct:   16 LNLNGSGGGASGPSSAFFGTSLKKVISSRVPNSKLTSGSFKIVAADKEIEETQQTEGDRWRGLAYDVSDDQQDITRGKGLVDSLFQAPMDAGTHYAVISSHKYLSAGLRQYNFDNIKDGFYIAPAFLDKLVVHIAKNFMTLPNIKVPLILGVWGGKGQG 174          

HSP 2 Score: 64.3142 bits (155), Expect = 2.282e-80
Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREASD+IKKGKMC+L INDLDAGAG + G   Y
Sbjct:  209 LIRQRYREASDLIKKGKMCVLFINDLDAGAGRLGGTTQY 247          

HSP 3 Score: 59.3066 bits (142), Expect = 2.282e-80
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  175 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 206          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_PHAAU (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Phaseolus aureus GN=RCA PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 7.100e-79
Identity = 114/159 (71.70%), Postives = 128/159 (80.50%), Query Frame = 2
Query:  128 LSFNGSGAATSVPSSSFFGTSLNK-VSSRIPPSKVPSASFKITA---EADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            L+ NGSGA  S P+S+FFGTSL K V+SR+P SKV + SFKI A   E +E++QT +DRWKGLAYD SDDQQDITRGKG VD LFQAPM  GTHYAVMSSY+Y+S GLR   LDN  DG YIAPAF+DKL VHITKNFM+LPNIKV LIL IW GKGQG
Sbjct:   16 LNLNGSGAGASAPTSAFFGTSLKKAVASRVPNSKVTNGSFKIVAAEKEIEESQQTNKDRWKGLAYDISDDQQDITRGKGMVDPLFQAPMDAGTHYAVMSSYEYLSTGLR--QLDNIKDGFYIAPAFLDKLVVHITKNFMTLPNIKVPLILGIWGGKGQG 172          

HSP 2 Score: 60.077 bits (144), Expect = 7.100e-79
Identity = 28/39 (71.79%), Postives = 31/39 (79.49%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+D+I KGKMC L INDLDAGAG + G   Y
Sbjct:  207 LIRQRYREAADLIAKGKMCALFINDLDAGAGRLGGTTQY 245          

HSP 3 Score: 59.3066 bits (142), Expect = 7.100e-79
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  173 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 204          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_CUCSA (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 4.884e-77
Identity = 104/163 (63.80%), Postives = 124/163 (76.07%), Query Frame = 2
Query:  104 SLMAAAVPLSFNGSGAATSVPSSSFFGTSLNKVSSRIPPSKVPSASFKITAEADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            S + A    + N S     VP+S+F G+ L KVSSR   SK+ + +FKI AE DE KQT++D+W+GLA+D SDDQQDITRGKG  D LFQAPMGTGTH AV+SSY+YIS GLR Y+ DN +DG YIAPAFMDKL VHI KNF++LPNIKV LIL +W GKGQG
Sbjct:    6 STIGAVNRTTLNNSNYGGLVPNSAFLGSRL-KVSSRFTTSKMVTGNFKIVAEQDEEKQTEKDKWRGLAFDTSDDQQDITRGKGLADPLFQAPMGTGTHNAVLSSYEYISAGLRDYSYDNNVDGFYIAPAFMDKLTVHIVKNFLTLPNIKVPLILGVWGGKGQG 167          

HSP 2 Score: 63.1586 bits (152), Expect = 4.884e-77
Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DIIKKGKMC L INDLDAGAG + G   Y
Sbjct:  202 LIRQRYREAADIIKKGKMCCLFINDLDAGAGRLGGTTQY 240          

HSP 3 Score: 59.3066 bits (142), Expect = 4.884e-77
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  168 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 199          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_ORYSJ (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Oryza sativa subsp. japonica GN=RCA PE=1 SV=2)

HSP 1 Score: 190.274 bits (482), Expect = 9.284e-72
Identity = 102/153 (66.67%), Postives = 115/153 (75.16%), Query Frame = 2
Query:  146 GAATSVPSSSFFGTSLNKVSSRIPPSKVPSAS---FKITA-EADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            GA  S P++ F G  L K  +        S++   FK+ A E DE KQT QDRWKGLAYD SDDQQDITRGKG VDSLFQAP G GTH AV+SSY+Y+SQGLRTY+ DNT+ G YIAPAFMDKL VHI+KNFM+LPNIKV LIL IW GKGQG
Sbjct:   10 GAPASTPTN-FLGKKLKKQVTSAVNYHGKSSNINRFKVMAKELDEGKQTDQDRWKGLAYDISDDQQDITRGKGFVDSLFQAPTGDGTHEAVLSSYEYLSQGLRTYDFDNTMGGFYIAPAFMDKLVVHISKNFMTLPNIKVPLILGIWGGKGQG 161          

HSP 2 Score: 64.3142 bits (155), Expect = 9.284e-72
Identity = 31/39 (79.49%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DIIKKGKMC L INDLDAGAG M G   Y
Sbjct:  196 LIRQRYREAADIIKKGKMCCLFINDLDAGAGRMGGTTQY 234          

HSP 3 Score: 59.3066 bits (142), Expect = 9.284e-72
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  162 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 193          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCAB_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase B, chloroplastic OS=Hordeum vulgare GN=RCAB PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.972e-68
Identity = 101/156 (64.74%), Postives = 115/156 (73.72%), Query Frame = 2
Query:  146 GAATSVPSSSFFGTSL-------NKVSSRIPPSKVPSASFKITAEADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            GA  S P+  F G  +       NK+ SR+   +V +A      E D+ KQT  DRWKGLAYD SDDQQDITRGKG VDSLFQAPMG GTH A++SSY+YISQGLR Y+ DNT+DGLYIAPAFMDKL VH+ KNFM+LPNIKV LIL IW GKGQG
Sbjct:   10 GAPASTPTI-FLGKKVKNYYHGGNKMKSRVV--RVMAAK----KELDQGKQTDADRWKGLAYDISDDQQDITRGKGIVDSLFQAPMGDGTHEAILSSYEYISQGLRKYDFDNTMDGLYIAPAFMDKLIVHLAKNFMTLPNIKVPLILGIWGGKGQG 158          

HSP 2 Score: 62.3882 bits (150), Expect = 1.972e-68
Identity = 30/39 (76.92%), Postives = 31/39 (79.49%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+DII KGKMC L INDLDAGAG M G   Y
Sbjct:  192 LIRQRYREAADIINKGKMCCLFINDLDAGAGRMGGTTQY 230          

HSP 3 Score: 53.1434 bits (126), Expect = 1.972e-68
Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S N GEP
Sbjct:  159 KSFQCELVFAKMGINPIMMSAGELESGN-GEP 189          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCAA_HORVU (Ribulose bisphosphate carboxylase/oxygenase activase A, chloroplastic OS=Hordeum vulgare GN=RCAA PE=2 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 5.664e-68
Identity = 95/152 (62.50%), Postives = 112/152 (73.68%), Query Frame = 2
Query:  146 GAATSVPSSSFFGTSLNK-VSSRIPPSKVPSASFKITAEADENKQTKQ--DRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            GA  S P++ F G  L K V+S +      S + + T  A EN   K+  D+WKGLAYD SDDQQDITRGKG VDSLFQAP G GTH AV+SSY+Y+SQGLR Y+ DNT+ G YIAPAFMDKL VH++KNFM+LPNIK+ LIL IW GKGQG
Sbjct:   10 GAPASTPTN-FLGKKLKKQVTSAVNYHGKSSKANRFTVMAAENIDEKRNTDKWKGLAYDISDDQQDITRGKGIVDSLFQAPTGHGTHEAVLSSYEYVSQGLRKYDFDNTMGGFYIAPAFMDKLVVHLSKNFMTLPNIKIPLILGIWGGKGQG 160          

HSP 2 Score: 63.1586 bits (152), Expect = 5.664e-68
Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+D+IKKGKMC L INDLDAGAG M G   Y
Sbjct:  195 LIRQRYREAADMIKKGKMCCLFINDLDAGAGRMGGTTQY 233          

HSP 3 Score: 59.3066 bits (142), Expect = 5.664e-68
Identity = 28/32 (87.50%), Postives = 29/32 (90.62%), Query Frame = 1
Query:  592 KSFQCELVFAKMGINPIMMSAGDX*SANAGEP 687
            KSFQCELVFAKMGINPIMMSAG+  S NAGEP
Sbjct:  161 KSFQCELVFAKMGINPIMMSAGELESGNAGEP 192          
BLAST of EY659343 vs. ExPASy Swiss-Prot
Match: RCA_ARATH (Ribulose bisphosphate carboxylase/oxygenase activase, chloroplastic OS=Arabidopsis thaliana GN=RCA PE=1 SV=2)

HSP 1 Score: 213.772 bits (543), Expect = 3.665e-67
Identity = 113/171 (66.08%), Postives = 130/171 (76.02%), Query Frame = 2
Query:  110 MAAAV---------PLSFNGSGA-ATSVPSSSFFGTSLNKVSSRIPPSKVPSASFKITAEADENKQTKQDRWKGLAYDESDDQQDITRGKGAVDSLFQAPMGTGTHYAVMSSYDYISQGLRTYNLDNTIDGLYIAPAFMDKLGVHITKNFMSLPNIKVHLILSIW*GKGQG 592
            MAAAV         PLS NGSG+ A S P+S+F G  +  VS     +K  + SFK+ A   E+KQT  DRW+GLAYD SDDQQDITRGKG VDS+FQAPMGTGTH+AV+SSY+Y+SQGLR YNLDN +DG YIAPAFMDKL VHITKNF++LPNIKV LIL IW GKGQG
Sbjct:    1 MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLA-VKEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLRQYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQG 170          

HSP 2 Score: 63.5438 bits (153), Expect = 3.665e-67
Identity = 30/39 (76.92%), Postives = 32/39 (82.05%), Query Frame = 3
Query:  693 LIRQRYREASDIIKKGKMCLLLINDLDAGAGPMEGPPHY 809
            LIRQRYREA+D+IKKGKMC L INDLDAGAG M G   Y
Sbjct:  205 LIRQRYREAADLIKKGKMCCLFINDLDAGAGRMGGTTQY 243          
The following BLAST results are available for this feature:
BLAST of EY659343 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
RCA1_LARTR4.314e-8272.78Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA2_LARTR4.319e-8272.78Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_MALDO2.751e-8171.15Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAVU2.282e-8070.44Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_PHAAU7.100e-7971.70Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_CUCSA4.884e-7763.80Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ORYSJ9.284e-7266.67Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAB_HORVU1.972e-6864.74Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCAA_HORVU5.664e-6862.50Ribulose bisphosphate carboxylase/oxygenase activa... [more]
RCA_ARATH3.665e-6766.08Ribulose bisphosphate carboxylase/oxygenase activa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-B04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659343 ID=EY659343|Name=EY659343|organism=Citrus sinensis|type=EST|length=923bp
CCACGCGTCCGCAACACGCACTCACCGCATTGCTTCACTTTCCTTTGCCT
GCATTACAGCGTGACCCTTTAGCTACTTCAATCACTGCCGTCCAATTCTC
GCTAGCCTAATGGCTGCTGCTGTACCGCTGAGCTTCAATGGCTCTGGTGC
TGCAACCTCTGTCCCAAGCTCATCTTTCTTTGGCACCAGCTTGAACAAGG
TAAGCTCAAGGATCCCCCCATCCAAGGTCCCTTCTGCGAGCTTCAAGATT
ACTGCTGAAGCCGATGAGAACAAGCAGACCAAGCAGGACAGATGGAAGGG
CCTTGCCTACGACGAATCTGATGACCAACAAGACATCACCAGAGGAAAAG
GTGCTGTGGACTCTCTGTTCCAAGCCCCCATGGGAACCGGAACTCACTAT
GCTGTCATGAGTTCTTATGACTACATCAGCCAAGGTCTCCGCACATACAA
CTTGGACAACACGATCGACGGTCTCTACATTGCCCCTGCTTTCATGGACA
AGCTTGGTGTTCACATCACCAAGAACTTCATGTCCCTGCCCAACATCAAG
GTTCATCTCATCTTGAGTATTTGGTGAGGCAAAGGACAAGGAAATCATTC
CAATGTGAGCTTGTTTTCGCCAAGATGGGCATCAACCCAATTATGATGAG
TGCCGGAGATTNGTGAAGTGCCAATGCTGGAGAACCGCCTAATTGATCAG
GCAAAGGTACCGTGAGGCATCTGACATTATCAAGAAAGGAAAAATGTGCC
TGCTCCTGATCAATGATCTCGACGCCGGAGCTGGTCCTATGGAGGGGCCC
CCCCATTACCACTTTACCACCAATGGGTTACCCCCACCCCTGACATTGCT
GATAACCCACTTGGGCCCACTCCCTGGATGACAACCAGGGGAAAACCCCC
GGGCCCAACATAGACCGGAACCA
back to top