EY659338

Overview
NameEY659338
Unique NameEY659338
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: EFR_ARATH (LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 4.055e-36
Identity = 90/260 (34.62%), Postives = 129/260 (49.62%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNN-YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG--PXLXXIVTL 787
            SG IP + G LRNL WLG+ NN                ANC +L  + +  N L G LP+SI NLS +L +L++G   ISG IP  IG               +G +P +FG+L  LQ + L  N + G  P    ++ RL KL L  N   G IP  L     L  L++ +NR    IP     +  + + D S+NFL G    ++G L++L+G+  S N LSG MP  IGG   ++ + +  N  +G  P +  +V+L
Sbjct:  303 SGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANLSTTLTSLFLGQNLISGTIPHDIGNLVSLQELSLETNMLSGELPVSFGKLLNLQVVDLYSNAISGEIPSYFGNMTRLQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSL 562          

HSP 2 Score: 113.62 bits (283), Expect = 1.598e-24
Identity = 81/267 (30.34%), Postives = 124/267 (46.44%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLT-SLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVL--LGI---NLSENNLSG-DMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTL 787
            ++F   IP  +G L  L++L +  N               +NC +L  + L+ N L   +PS +G+LS  L  L +   +++GN P S+G                G IP    RL ++    +A N   G FP  L ++  L+ L L  N  SG++ +    L  +LR L LG+N+FT  IP T  ++  +  FD SSN+L G +    G L+ L  LGI   +L  N+ SG +    +     L+ +D+ YNRL G     I  L
Sbjct:  107 NSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSL-----SNCSRLSTVDLSSNHLGHGVPSELGSLS-KLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTGAIPKTLANISSLERFDISSNYLSGSIPLSFGKLRNLWWLGIRNNSLGNNSSSGLEFIGAVANCTQLEYLDVGYNRLGGELPASIANL 367          

HSP 3 Score: 99.3673 bits (246), Expect = 3.119e-20
Identity = 76/234 (32.48%), Postives = 112/234 (47.86%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFG---NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIP--STFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPAT 703
            SG IP+ IGNL +L+ L L  N                    L+ + L  N ++G +PS  GN++  L+ L++ + S  G IPQS+G                G IP    ++  L  + L+ N L G FP+E+   G+L+ LV  G   NKLSG +P  +    S+  L++  N F   IP  S   SLK++   DFS+N L G +   + +L  L  +NLS N   G +P T
Sbjct:  382 SGTIPHDIGNLVSLQELSLETNMLSGELPVSF-----GKLLNLQVVDLYSNAISGEIPSYFGNMTR-LQKLHLNSNSFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIPSLAYIDLSNNFLTGHFPEEV---GKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPDISRLVSLKNV---DFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTT 603          

HSP 4 Score: 90.5077 bits (223), Expect = 1.449e-17
Identity = 63/209 (30.14%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGG-LKDLQIMDLAYNRLEG 760
            +++  + L G  L G++  SIGNLS  L+ L + + S    IPQ +G                G IP++     +L  + L+ N L    P EL  L +L  L L  N L+G+ P+ L NLTSL+ L    N+    IP     L  ++FF  + N   G     + N+  L  ++L++N+ SG++ A  G  L +L+ + L  N+  G
Sbjct:   73 ERVISLNLGGFKLTGVISPSIGNLSF-LRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSLESLSLADNSFSGNLRADFGYLLPNLRRLLLGTNQFTG 280          

HSP 5 Score: 78.1814 bits (191), Expect = 2.994e-14
Identity = 52/158 (32.91%), Postives = 75/158 (47.47%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG---PXLXXIVTL 787
            TG I  + G L  L+ L LA N    + P ++  L RL  L +  N L G IPS LSN + L ++ L SN     +PS   SL  +   D S N L G   + +GNL  L  ++ + N + G++P  +  L  +    +A N   G   P L  I +L
Sbjct:   86 TGVISPSIGNLSFLRLLNLADNSFGSTIPQKVGRLFRLQYLNMSYNLLEGRIPSSLSNCSRLSTVDLSSNHLGHGVPSELGSLSKLAILDLSKNNLTGNFPASLGNLTSLQKLDFAYNQMRGEIPDEVARLTQMVFFQIALNSFSGGFPPALYNISSL 243          

HSP 6 Score: 21.557 bits (44), Expect = 2.994e-14
Identity = 11/28 (39.29%), Postives = 17/28 (60.71%), Query Frame = 1
Query:  781 DFDSLESLNLSNIKSPGLFQNPWGTLLP 864
            +  SLESL+L++    G  +  +G LLP
Sbjct:  239 NISSLESLSLADNSFSGNLRADFGYLLP 266          

HSP 7 Score: 78.9518 bits (193), Expect = 4.363e-14
Identity = 53/186 (28.49%), Postives = 87/186 (46.77%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPST 559
            +++A SG IP+  GN+  L+ L L +N                 C+ L D+ +  N LNG +P  I  +  SL  + + N  ++G+ P+ +G               +G +P   G    ++ L++  N   G+ PD +  L  L  +    N LSG IP  L++L SLR+L L  N+F   +P+T
Sbjct:  425 YSNAISGEIPSYFGNMTRLQKLHLNSN-----SFHGRIPQSLGRCRYLLDLWMDTNRLNGTIPQEILQIP-SLAYIDLSNNFLTGHFPEEVGKLELLVGLGASYNKLSGKMPQAIGGCLSMEFLFMQGNSFDGAIPD-ISRLVSLKNVDFSNNNLSGRIPRYLASLPSLRNLNLSMNKFEGRVPTT 603          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RCH2_ARATH (Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 6.060e-32
Identity = 100/277 (36.10%), Postives = 130/277 (46.93%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKL------------------------QGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + ++ SG IP  IG L  LE L L  N                NC  L+ I L+ N L+G +PSSIG LS  L+   I +   SG+IP +I                +G IP+  G L KL                        Q L L+ N L G+ P  L  L  L KL+L  N LSG IP  + N +SL  L LG NR T  IPS   SLK I F DFSSN L G +  +IG+   L  I+LS N+L G +P  +  L  LQ++D++ N+  G
Sbjct:  282 YENSLSGSIPREIGQLTKLEQLFLWQN-----SLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSF-LEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSG 552          

HSP 2 Score: 123.635 bits (309), Expect = 1.545e-27
Identity = 82/248 (33.06%), Postives = 117/248 (47.18%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIG-NCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP ++  LRNLE L L +N               + C KL+ + L  N L G +P+ +G LS  L+ + IG N  ISG IP  IG               +G +P++ G+L+KL+ L +    + G  P +L +   L  L L+ N LSGSIP  +  LT L  L+L  N     IP    +  ++   D S N L G + S IG L  L    +S+N  SG +P TI     L  + L  N++ G
Sbjct:  143 GDIPWSLSKLRNLETLILNSNQLTGKIPPDI-----SKCSKLKSLILFDNLLTGSIPTELGKLS-GLEVIRIGGNKEISGQIPSEIGDCSNLTVLGLAETSVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISG 384          

HSP 3 Score: 123.635 bits (309), Expect = 1.545e-27
Identity = 80/248 (32.26%), Postives = 116/248 (46.77%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP  +G L  LE + +G N                +C  L  +GL    ++G LPSS+G L   L+TL I    ISG IP  +G               +G IP   G+L KL+ L+L  N LVG  P+E+ +   L  + L  N LSGSIPS +  L+ L    +  N+F+  IP+T  +   ++      N + G + S++G L  L       N L G +P  +    DLQ +DL+ N L G
Sbjct:  190 TGSIPTELGKLSGLEVIRIGGN----KEISGQIPSEIGDCSNLTVLGLAETSVSGNLPSSLGKLK-KLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTG 432          

HSP 4 Score: 120.939 bits (302), Expect = 1.001e-26
Identity = 92/293 (31.40%), Postives = 128/293 (43.69%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNN-------------------YXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQK------------------------LQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVL-LGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP TI N  +L  L L  N                   +              A+C  L+ + L+ N L G +PS +  L    K L I N S+SG IPQ IG               TG IP+  G L+K                        LQ + L+ N L GS P+ +  L  L  L +  N+ SG IP+ L  L SL  L L  N F+  IP++      +   D  SN L G + S++G+++ L + +NLS N L+G +P+ I  L  L I+DL++N LEG
Sbjct:  358 FSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISN-SLSGFIPQEIGNCSSLVRLRLGFNRITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCSELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIPSKIASLNKLSILDLSHNMLEG 649          

HSP 5 Score: 114.005 bits (284), Expect = 1.224e-24
Identity = 78/248 (31.45%), Postives = 120/248 (48.39%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP+ IG+  NL  LGL                     KKL  + +    ++G +PS +GN S  L  L++   S+SG+IP+ IG                G IP   G    L+ + L+ N L GS P  +  L  L++ ++  NK SGSIP+ +SN +SL  L L  N+ + +IPS   +L  +  F   SN L G +   + +   L  ++LS N+L+G +P+ +  L++L  + L  N L G
Sbjct:  215 SGQIPSEIGDCSNLTVLGLAET-----SVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCS-ELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVGGIPEEIGNCSNLKMIDLSLNLLSGSIPSSIGRLSFLEEFMISDNKFSGSIPTTISNCSSLVQLQLDKNQISGLIPSELGTLTKLTLFFAWSNQLEGSIPPGLADCTDLQALDLSRNSLTGTIPSGLFMLRNLTKLLLISNSLSG 456          

HSP 6 Score: 110.153 bits (274), Expect = 1.767e-23
Identity = 78/232 (33.62%), Postives = 114/232 (49.14%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            +++ SGFIP  IGN  +L  L LG N                + KK+  +  + N L+G +P  IG+ S  L+ + + N S+ G++P  +                +G IP + GRL  L  L L+ N   GS P  L     L  L L  N+LSG IPS L ++ +L  +L L SNR T  IPS   SL  +   D S N L G L + + N++ L+ +N+S N+ SG +P
Sbjct:  451 SNSLSGFIPQEIGNCSSLVRLRLGFN-----RITGEIPSGIGSLKKINFLDFSSNRLHGKVPDEIGSCS-ELQMIDLSNNSLEGSLPNPVSSLSGLQVLDVSANQFSGKIPASLGRLVSLNKLILSKNLFSGSIPTSLGMCSGLQLLDLGSNELSGEIPSELGDIENLEIALNLSSNRLTGKIPSKIASLNKLSILDLSHNMLEGDL-APLANIENLVSLNISYNSFSGYLP 675          

HSP 7 Score: 96.2857 bits (238), Expect = 2.641e-19
Identity = 68/231 (29.44%), Postives = 107/231 (46.32%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNR----------------------FTSV---IPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + DI +   PL   LP ++     SL+ L I   +++G +P+S+G                G IP +  +L+ L+ L L  N+L G  P ++    +L  L+LF N L+GSIP+ L  L+ L  + +G N+                       TSV   +PS+   LK +      +  + G + SD+GN   L+ + L EN+LSG +P  IG L  L+ + L  N L G
Sbjct:   83 ITDIDIESVPLQLSLPKNLPAFR-SLQKLTISGANLTGTLPESLGDCLGLKVLDLSSNGLVGDIPWSLSKLRNLETLILNSNQLTGKIPPDISKCSKLKSLILFDNLLTGSIPTELGKLSGLEVIRIGGNKEISGQIPSEIGDCSNLTVLGLAETSVSGNLPSSLGKLKKLETLSIYTTMISGEIPSDLGNCSELVDLFLYENSLSGSIPREIGQLTKLEQLFLWQNSLVG 312          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1571_ARATH (Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 3.007e-31
Identity = 87/272 (31.99%), Postives = 136/272 (50.00%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLY-------------IGNCS-----------ISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP+++GNL+NL  L L  NY               N + + D+ L+ N L G +PS++GNL  +L  LY             IGN             ++G+IP S+G               TG IP   G ++ +  L L+ NKL GS P  L +L  L  L L+ N L+G IP  L N+ S+  L L +N+ T  IPS+F +LK++ +     N+L G +  ++GN++ ++ ++LS+N L+G +P + G    L+ + L  N L G
Sbjct:  187 TGSIPSSLGNLKNLMVLYLYENYLTGVIPPEL-----GNMESMTDLALSQNKLTGSIPSTLGNLK-NLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSG 452          

HSP 2 Score: 134.035 bits (336), Expect = 1.143e-30
Identity = 81/248 (32.66%), Postives = 125/248 (50.40%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP   GNL  L +  L  N+               N K L  + L  N L  ++PS +GN+  S+  L +    ++G+IP S+G               TG IP   G ++ +  L L+ NKL GS P  L +L  L  L L+ N L+G IP  + N+ S+ +L L  N+ T  IPS+  +LK++       N+L G +   +GN++ ++ + LS N L+G +P+++G LK+L I+ L  N L G
Sbjct:  115 SGTIPPQFGNLSKLIYFDLSTNHLTGEISPSL-----GNLKNLTVLYLHQNYLTSVIPSELGNME-SMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTG 356          

HSP 3 Score: 132.88 bits (333), Expect = 2.546e-30
Identity = 78/253 (30.83%), Postives = 127/253 (50.20%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H +  +  IP+ +GN+ ++  L L  N                N K L  + L  N L G++P  +GN+  S+  L +    ++G+IP ++G               TG IP   G ++ +  L L+ NKL GS P  L +L  L  L LF N L+G IP  L N+ S+  L L +N+ T  IPS+  +LK++       N+L G +  ++GN++ ++ + L+ N L+G +P++ G LK+L  + L  N L G
Sbjct:  158 HQNYLTSVIPSELGNMESMTDLALSQN-----KLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNME-SMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTG 404          

HSP 4 Score: 127.872 bits (320), Expect = 8.190e-29
Identity = 85/248 (34.27%), Postives = 120/248 (48.39%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP+T+GNL+NL  L L  NY               N + + ++ L+ N L G +PSS+GNL  +L  L +    ++G IP  +G               TG IP++ G L+ L  LYL  N L G  P EL ++  +  L L  NKL+GSIPS   NL +L  LYL  N  T VIP    +++ ++  D S N L G +    GN   L  + L  N+LSG +P  +     L  + L  N   G
Sbjct:  235 TGSIPSTLGNLKNLMVLYLYENYLTGVIPPEI-----GNMESMTNLALSQNKLTGSIPSSLGNLK-NLTLLSLFQNYLTGGIPPKLGNIESMIDLELSNNKLTGSIPSSLGNLKNLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTG 476          

HSP 5 Score: 120.168 bits (300), Expect = 1.708e-26
Identity = 82/272 (30.15%), Postives = 122/272 (44.85%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFN------------------------KLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP+++GNL+NL  L L  NY               N + + D+ L+ N L G +PSS+GNL  +L  LY+    ++G IP  +G               TG IP++FG L+ L  LYL  N                        KL GS PD   +  +L+ L L  N LSG+IP  ++N + L +L L +N FT   P T    + +       N L GP+   + + K L+      N  +GD+    G   DL  +D ++N+  G
Sbjct:  283 TGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKL-----GNIESMIDLELSNNKLTGSIPSSLGNLK-NLTILYLYENYLTGVIPPELGNMESMIDLQLNNNKLTGSIPSSFGNLKNLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSLIRARFLGNKFTGDIFEAFGIYPDLNFIDFSHNKFHG 548          

HSP 6 Score: 115.931 bits (289), Expect = 3.221e-25
Identity = 88/273 (32.23%), Postives = 125/273 (45.79%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGS------------------------FPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSL-RSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP+++GNL+NL  L L  NY               N + + D+ L  N L G +PSS GNL  +L  LY+    ++G IPQ +G               TG +P +FG   KL+ LYL  N L G+                        FP+ +C   +L  + L  N L G IP  L +  SL R+ +LG N+FT  I   F    D+ F DFS N   G +SS+      L  + +S NN++G +P  I  +  L  +DL+ N L G
Sbjct:  331 TGSIPSSLGNLKNLTILYLYENYLTGVIPPEL-----GNMESMIDLQLNNNKLTGSIPSSFGNLK-NLTYLYLYLNYLTGVIPQELGNMESMINLDLSQNKLTGSVPDSFGNFTKLESLYLRVNHLSGAIPPGVANSSHLTTLILDTNNFTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLRDCKSLIRARFLG-NKFTGDIFEAFGIYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFG 596          

HSP 7 Score: 107.071 bits (266), Expect = 1.496e-22
Identity = 84/273 (30.77%), Postives = 121/273 (44.32%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWS-----------------------LKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            F+GF P T+   R L+ + L  N+               +CK L      GN   G +  + G +   L  +   +    G I  +                 TG IPT    + +L  L L+ N L G  P+ + +L  L +L L GN+LSG +P+ LS LT+L SL L SN F+S IP TF S                       L  +   D S N L G + S + +L+ L  ++LS NNLSG +P T  G+  L  +D++ N+LEGP
Sbjct:  474 FTGFFPETVCKGRKLQNISLDYNHLEGPIPKSLR-----DCKSLIRARFLGNKFTGDIFEAFG-IYPDLNFIDFSHNKFHGEISSNWEKSPKLGALIMSNNNITGAIPTEIWNMTQLVELDLSTNNLFGELPEAIGNLTNLSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIPRLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGMIALTNVDISNNKLEGP 740          

HSP 8 Score: 104.375 bits (259), Expect = 9.697e-22
Identity = 68/208 (32.69%), Postives = 99/208 (47.60%), Query Frame = 2
Query:  248 ISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLY------------------------LGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG---PXLXXIVTLI 790
            +SG IP   G               TG I  + G L+ L  LYL  N L    P EL ++  +  L L  NKL+GSIPS L NL +L  LY                        L  N+ T  IPST  +LK+++      N+L G +  +IGN++ +  + LS+N L+G +P+++G LK+L ++ L  N L G   P L  I ++I
Sbjct:  114 LSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTGSIPSTLGNLKNLMVLYLYENYLTGVIPPEIGNMESMTNLALSQNKLTGSIPSSLGNLKNLTLLSLFQNYLTGGIPPKLGNIESMI 321          

HSP 9 Score: 85.5001 bits (210), Expect = 4.661e-16
Identity = 59/164 (35.98%), Postives = 83/164 (50.61%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPL 622
            N  +L ++ L+ N L G LP +IGNL+ +L  L +    +SG +P  +                +  IP TF    KL  + L+ NK  GS P  L  L +L +L L  N+L G IPS LS+L SL  L L  N  + +IP+TF  +  +   D S+N L GPL
Sbjct:  580 NMTQLVELDLSTNNLFGELPEAIGNLT-NLSRLRLNGNQLSGRVPAGLSFLTNLESLDLSSNNFSSEIPQTFDSFLKLHDMNLSRNKFDGSIP-RLSKLTQLTQLDLSHNQLDGEIPSQLSSLQSLDKLDLSHNNLSGLIPTTFEGMIALTNVDISNNKLEGPL 741          

HSP 10 Score: 82.0333 bits (201), Expect = 5.154e-15
Identity = 50/139 (35.97%), Postives = 75/139 (53.96%), Query Frame = 2
Query:  344 FGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F  L  L  + L+ N L G+ P +  +L +L    L  N L+G I   L NL +L  LYL  N  TSVIPS   +++ +     S N L G + S +GNLK L+ + L EN L+G +P  +G ++ +  + L+ N+L G
Sbjct:   98 FISLSNLAYVDLSMNLLSGTIPPQFGNLSKLIYFDLSTNHLTGEISPSLGNLKNLTVLYLHQNYLTSVIPSELGNMESMTDLALSQNKLTGSIPSSLGNLKNLMVLYLYENYLTGVIPPELGNMESMTDLALSQNKLTG 236          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y3475_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 3.928e-31
Identity = 89/258 (34.50%), Postives = 128/258 (49.61%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLG-NNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG--PXLXXIV 781
            +G IP T GN+ NL+ L L  N+                NC +L  +G+  N L G LP SI NLS  L TL +G   ISG+IP  IG               +GP+PT+ G+L  L+ L L  N+L G  P  + ++  L+ L L  N   G +P+ L N + L  L++G N+    IP     ++ +L  D S N L+G L  DIG L+ L  ++L +N LSG +P T+G    ++ + L  N   G  P L  +V
Sbjct:  296 TGSIP-TFGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIPDLKGLV 552          

HSP 2 Score: 104.375 bits (259), Expect = 9.697e-22
Identity = 77/227 (33.92%), Postives = 106/227 (46.70%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMP 697
            SG IP  IGNL NL+ L L  N                    LR + L  N L+G +P+ IGN++M L+TL + N    G +P S+G                G IP    ++Q+L  L ++ N L+GS P ++  L  L  L L  NKLSG +P  L N  ++ SL+L  N F   IP     L  +   D S+N L G +     +   L  +NLS NNL G +P
Sbjct:  374 SGSIPYDIGNLINLQKLILDQNMLSGPLPTSL-----GKLLNLRYLSLFSNRLSGGIPAFIGNMTM-LETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSGKLPQTLGNCLTMESLFLEGNLFYGDIPD-LKGLVGVKEVDLSNNDLSGSIPEYFASFSKLEYLNLSFNNLEGKVP 593          

HSP 3 Score: 100.908 bits (250), Expect = 1.072e-20
Identity = 83/301 (27.57%), Postives = 127/301 (42.19%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNY--------------------XXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPS--SIGNLSM--------------------------SLKTLYIGNCSISGNIPQSI-GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            A+ FSG  P  + NL +L+ LG+G N+                                  +N   L  +G+  N L G +P+  ++ NL +                           L+TL IG   + G++P SI                 +G IP   G L  LQ L L  N L G  P  L  L  L  L LF N+LSG IP+ + N+T L +L L +N F  ++P++  +   +L      N L G +  +I  ++ LL +++S N+L G +P  IG L++L  + L  N+L G
Sbjct:  219 ANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIPTFGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLINLQKLILDQNMLSGPLPTSLGKLLNLRYLSLFSNRLSGGIPAFIGNMTMLETLDLSNNGFEGIVPTSLGNCSHLLELWIGDNKLNGTIPLEIMKIQQLLRLDMSGNSLIGSLPQDIGALQNLGTLSLGDNKLSG 519          

HSP 4 Score: 94.3597 bits (233), Expect = 1.003e-18
Identity = 83/291 (28.52%), Postives = 123/291 (42.27%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHL--------------GRL--------DKLVLF---GNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSD------IGNLKVLLGINLSENNLSGDMPATIGGLK-DLQIMDLAYNRLEGPXLXXIVTLI 790
            F G IP  +G L  LE+L +G NY               NC +L ++ L  N L G +PS +G+L+  ++    GN ++ G +P S+G                G IP+   +L ++  L L  N   G FP  L +L              GRL          L+ F   GN  +GSIP+ LSN+++L  L +  N  T  IP TF ++ ++      +N L    S D      + N   L  + +  N L GD+P +I  L   L  +DL    + G     I  LI
Sbjct:  102 FGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLY-----NCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGN-NMRGKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTGSIP-TFGNVPNLKLLFLHTNSLGSDSSRDLEFLTSLTNCTQLETLGIGRNRLGGDLPISIANLSAKLVTLDLGGTLISGSIPYDIGNLI 385          

HSP 5 Score: 91.2781 bits (225), Expect = 8.495e-18
Identity = 69/233 (29.61%), Postives = 98/233 (42.06%), Query Frame = 2
Query:  137 KKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR------------------------SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIG-NLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            K++  + L    L G++  SIGNLS  L +L +      G IPQ +G                GPIP       +L  L L  N+L GS P EL  L  L +L L+GN + G +P+ L NLT L                         SL L +N F+ V P   ++L  +       N   G L  D+G  L  LL  N+  N  +G +P T+  +  L+ + +  N L G
Sbjct:   66 KRVTHLELGRLQLGGVISPSIGNLSF-LVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSGRLRPDLGILLPNLLSFNMGGNYFTGSIPTTLSNISTLERLGMNENNLTG 297          

HSP 6 Score: 85.8853 bits (211), Expect = 3.569e-16
Identity = 57/187 (30.48%), Postives = 84/187 (44.92%), Query Frame = 2
Query:  200 GNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G  +  +  L +G   + G I  SIG                G IP   G+L +L+ L +  N L G  P  L +  RL  L L  N+L GS+PS L +LT+L  L L  N     +P++  +L  +     S N L G + SD+  L  +  + L  NN SG  P  +  L  L+++ + YN   G
Sbjct:   62 GRKNKRVTHLELGRLQLGGVISPSIGNLSFLVSLDLYENFFGGTIPQEVGQLSRLEYLDMGINYLRGPIPLGLYNCSRLLNLRLDSNRLGGSVPSELGSLTNLVQLNLYGNNMRGKLPTSLGNLTLLEQLALSHNNLEGEIPSDVAQLTQIWSLQLVANNFSGVFPPALYNLSSLKLLGIGYNHFSG 248          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.750e-31
Identity = 88/251 (35.06%), Postives = 127/251 (50.60%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCK--KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP+ I  L+N+ +L L NN                 CK   L  IG   N L G +P  +G+L      +  GN  ++G+IP SIG               TG IP  FG L  LQ L L  N L G  P E+ +   L +L L+ N+L+G IP+ L NL  L++L +  N+ TS IPS+ + L  +     S N LVGP+S +IG L+ L  + L  NN +G+ P +I  L++L ++ + +N + G
Sbjct:  132 FSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEI-------CKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGN-HLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISG 374          

HSP 2 Score: 106.686 bits (265), Expect = 1.954e-22
Identity = 78/272 (28.68%), Postives = 120/272 (44.12%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLG-------------------NNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H++ F+G  P +I NLRNL  L +G                   N                +NC  L+ + L+ N + G +P   G   M+L  + IG    +G IP  I                TG +    G+LQKL+ L +++N L G  P E+ +L  L+ L L  N  +G IP  +SNLT L+ L + SN     IP   + +K +   D S+N   G + +    L+ L  ++L  N  +G +PA++  L  L   D++ N L G
Sbjct:  344 HSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGR--MNLTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTG 613          

HSP 3 Score: 106.301 bits (264), Expect = 2.552e-22
Identity = 86/284 (30.28%), Postives = 125/284 (44.01%), Query Frame = 2
Query:   38 IGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFG---NKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXLXXIVTLIV*KV*ICQI*NLRVY-----SKIXGELFYL 865
            IG+LR+  W G+  +                +   +  + L    L G+L  +I NL+  L+ L + + S +G IP  IG               +G IP+    L+ +  L L  N L G  P+E+C   +   LVL G   N L+G IP CL +L  L+      N  T  IP +  +L ++   D S N L G +  D GNL  L  + L+EN L GD+PA IG    L  ++L  N+L G     +  L+       Q+  LR+Y     S I   LF L
Sbjct:   55 IGSLRHCNWTGITCD----------------STGHVVSVSLLEKQLEGVLSPAIANLTY-LQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEIC---KTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLV-------QLQALRIYKNKLTSSIPSSLFRL 311          

HSP 4 Score: 104.375 bits (259), Expect = 9.697e-22
Identity = 75/248 (30.24%), Postives = 114/248 (45.97%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP +IG L NL  L L  N                N   L+ + LT N L G +P+ IGN S SL  L + +  ++G IP  +G               T  IP++  RL +L  L L+ N LVG   +E+  L  L+ L L  N  +G  P  ++NL +L  L +G N  +  +P+    L ++       N L GP+ S I N   L  ++LS N ++G++P   G + +L  + +  N   G
Sbjct:  205 TGSIPVSIGTLANLTDLDLSGNQLTGKIPRDF-----GNLLNLQSLVLTENLLEGDIPAEIGNCS-SLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGPISEEIGFLESLEVLTLHSNNFTGEFPQSITNLRNLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRM-NLTFISIGRNHFTG 445          

HSP 5 Score: 100.908 bits (250), Expect = 1.072e-20
Identity = 83/279 (29.75%), Postives = 122/279 (43.73%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQK------------------------LQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSD-IGNLK-VLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H +  +G IP++I N   L+ L L +N                    L  I +  N   G +P  I N S +L+TL + + +++G +   IG               TGPIP   G L+                         LQGL +  N L G  P+E+  +  L  L L  NK SG IP+  S L SL  L L  N+F   IP++  SL  +  FD S N L G +  + + +LK + L +N S N L+G +P  +G L+ +Q +DL+ N   G
Sbjct:  392 HDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRM------NLTFISIGRNHFTGEIPDDIFNCS-NLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSG 663          

HSP 6 Score: 94.7449 bits (234), Expect = 7.683e-19
Identity = 68/235 (28.94%), Postives = 104/235 (44.26%), Query Frame = 2
Query:  128 ANCKKLRDIGLTGNPLNGILPSSIGNLS--------------------MSLKTLY---IGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            AN   L+ + LT N   G +P+ IG L+                      LK ++   + N  +SG++P+ I                TG IP   G L  LQ    A N L GS P  +  L  L  L L GN+L+G IP    NL +L+SL L  N     IP+   +   ++  +   N L G + +++GNL  L  + + +N L+  +P+++  L  L  + L+ N L GP
Sbjct:   93 ANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWELKNIFYLDLRNNLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPECLGDLVHLQMFVAAGNHLTGSIPVSIGTLANLTDLDLSGNQLTGKIPRDFGNLLNLQSLVLTENLLEGDIPAEIGNCSSLVQLELYDNQLTGKIPAELGNLVQLQALRIYKNKLTSSIPSSLFRLTQLTHLGLSENHLVGP 327          

HSP 7 Score: 94.7449 bits (234), Expect = 7.683e-19
Identity = 74/256 (28.91%), Postives = 115/256 (44.92%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAF--NKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPS-TFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            H++ F+G IP  + NL  L+ L + +N                + K L  + L+ N  +G +P+    L  SL  L +     +G+IP S+                TG IP       K   LYL F  N L G+ P EL  L  + ++ L  N  SGSIP  L    ++ +L    N  +  IP   F  +  I+  + S N   G +    GN+  L+ ++LS NNL+G++P ++  L  L+ + LA N L+G
Sbjct:  511 HSNGFTGRIPREMSNLTLLQGLRMYSN-----DLEGPIPEEMFDMKLLSVLDLSNNKFSGQIPALFSKLE-SLTYLSLQGNKFNGSIPASLKSLSLLNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKG 760          

HSP 8 Score: 93.2041 bits (230), Expect = 2.235e-18
Identity = 70/246 (28.46%), Postives = 107/246 (43.50%), Query Frame = 2
Query:   26 IPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            IP+++  L  L  LGL  N+                 + L  + L  N   G  P SI NL  +L  L +G  +ISG +P  +G               TGPIP++      L+ L L+ N++ G  P     +  L  + +  N  +G IP  + N ++L +L +  N  T  +      L+ +     S N L GP+  +IGNLK L  + L  N  +G +P  +  L  LQ + +  N LEGP
Sbjct:  304 IPSSLFRLTQLTHLGLSENHLVGPISEEIGFL-----ESLEVLTLHSNNFTGEFPQSITNLR-NLTVLTVGFNNISGELPADLGLLTNLRNLSAHDNLLTGPIPSSISNCTGLKLLDLSHNQMTGEIPRGFGRMN-LTFISIGRNHFTGEIPDDIFNCSNLETLSVADNNLTGTLKPLIGKLQKLRILQVSYNSLTGPIPREIGNLKDLNILYLHSNGFTGRIPREMSNLTLLQGLRMYSNDLEGP 542          

HSP 9 Score: 92.0485 bits (227), Expect = 4.980e-18
Identity = 72/252 (28.57%), Postives = 113/252 (44.84%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSI--GXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPS-CLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYN 748
            +++   G IP  + +++ L  L L NN               +  + L  + L GN  NG +P+S+ +LS+ L T  I +  ++G IP  +                  TG IP   G+L+ +Q + L+ N   GS P  L     +  L    N LSG IP      +  + SL L  N F+  IP +F ++  ++  D SSN L G +   + NL  L  + L+ NNL G +P + G  K++   DL  N
Sbjct:  535 YSNDLEGPIPEEMFDMKLLSVLDLSNN-----KFSGQIPALFSKLESLTYLSLQGNKFNGSIPASLKSLSL-LNTFDISDNLLTGTIPGELLASLKNMQLYLNFSNNLLTGTIPKELGKLEMVQEIDLSNNLFSGSIPRSLQACKNVFTLDFSQNNLSGHIPDEVFQGMDMIISLNLSRNSFSGEIPQSFGNMTHLVSLDLSSNNLTGEIPESLANLSTLKHLKLASNNLKGHVPES-GVFKNINASDLMGN 779          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y1341_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2)

HSP 1 Score: 127.102 bits (318), Expect = 1.397e-28
Identity = 86/252 (34.13%), Postives = 124/252 (49.21%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            A+  +G IP  +G L  LE L L +N               +NC  L  + L  N L+G +PS IGNL  SL++ ++   SISG IP S                        FG    L  L L+ NKL G  P+EL  L RL KL+L GN LSG +P  ++   SL  L +G N+ +  IP     L++++F D   N   G L  +I N+ VL  +++  N ++GD+PA +G L +L+ +DL+ N   G
Sbjct:  317 ANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWEL-----SNCSSLIALQLDKNKLSGSIPSQIGNLK-SLQSFFLWENSISGTIPSS------------------------FGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTG 538          

HSP 2 Score: 122.094 bits (305), Expect = 4.494e-27
Identity = 83/249 (33.33%), Postives = 123/249 (49.40%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQI-MDLAYNRLEG 760
            SG IP+ IGNL++L+   L  N                NC  L  + L+ N L G +P  + +L    K L +GN S+SG +P+S+                +G IP   G LQ L  L L  N   G  P E+ ++  L+ L +  N ++G IP+ L NL +L  L L  N FT  IP +F +L  +     ++N L G +   I NL+ L  ++LS N+LSG++P  +G +  L I +DL+YN   G
Sbjct:  369 SGSIPSQIGNLKSLQSFFLWEN-----SISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGN-SLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEIGELQNLVFLDLYMNHFSGGLPYEISNITVLELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTG 611          

HSP 3 Score: 121.324 bits (303), Expect = 7.665e-27
Identity = 93/300 (31.00%), Postives = 129/300 (43.00%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQ------------------------GLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTS------------------------LRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +++ SG IP+ +G L  L++L L  N               +N   L+ + L  N LNG +PSS G+L    +    GN ++ G IP  +G               +G IP+TFG L  LQ                         LYL  NKL GS P EL  L ++  L+L+GN LSG IP  +SN +S                        L  L L  N FT  IP    +   ++      N L G + S IGNLK L    L EN++SG +P++ G   DL  +DL+ N+L G
Sbjct:  124 SNSLSGPIPSELGRLSTLQFLILNAN-----KLSGSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLGFAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENSISGTIPSSFGNCTDLVALDLSRNKLTG 418          

HSP 4 Score: 111.309 bits (277), Expect = 7.932e-24
Identity = 85/272 (31.25%), Postives = 125/272 (45.96%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCH---------------------LGRL---DKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP++ G+L +L+   LG N                  K L  +G   + L+G +PS+ GNL ++L+TL + +  ISG IP  +G               TG IP   G+LQK+  L L  N L G  P E+ +                     LG+L   ++L L  N  +G IP  LSN +SL +L L  N+ +  IPS   +LK +  F    N + G + S  GN   L+ ++LS N L+G +P  +  LK L  + L  N L G
Sbjct:  176 NGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFL----KNLTTLGFAASGLSGSIPSTFGNL-VNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTGSIPKELGKLQKITSLLLWGNSLSGVIPPEISNCSSLVVFDVSANDLTGDIPGDLGKLVWLEQLQLSDNMFTGQIPWELSNCSSLIALQLDKNKLSGSIPSQIGNLKSLQSFFLWENSISGTIPSSFGNCTDLVALDLSRNKLTGRIPEELFSLKRLSKLLLLGNSLSG 442          

HSP 5 Score: 101.679 bits (252), Expect = 6.285e-21
Identity = 70/193 (36.27%), Postives = 100/193 (51.81%), Query Frame = 2
Query:  191 SSIGNLSM--SLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSN-RFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SSI +LS   SL+ L + + ++SG IP S G               +GPIP+  GRL  LQ L L  NKL GS P ++ +L  L  L L  N L+GSIPS   +L SL+   LG N      IP+    LK++    F+++ L G + S  GNL  L  + L +  +SG +P  +G   +L+ + L  N+L G
Sbjct:   82 SSIPDLSSLSSLQFLNLSSTNLSGPIPPSFGKLTHLRLLDLSSNSLSGPIPSELGRLSTLQFLILNANKLSGSIPSQISNLFALQVLCLQDNLLNGSIPSSFGSLVSLQQFRLGGNTNLGGPIPAQLGFLKNLTTLGFAASGLSGSIPSTFGNLVNLQTLALYDTEISGTIPPQLGLCSELRNLYLHMNKLTG 274          

HSP 6 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 78/233 (33.48%), Postives = 111/233 (47.64%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPAT 703
            ++ SG +P ++   ++L  L +G N                  + L  + L  N  +G LP  I N+++ L+ L + N  I+G+IP  +G               TG IP +FG L  L  L L  N L G  P  + +L +L  L L  N LSG IP  L  +TSL  +L L  N FT  IP TF  L  +   D SSN L G +   +G+L  L  +N+S NN SG +P+T
Sbjct:  438 NSLSGGLPKSVAKCQSLVRLRVGENQLSGQIPKEI-----GELQNLVFLDLYMNHFSGGLPYEISNITV-LELLDVHNNYITGDIPAQLGNLVNLEQLDLSRNSFTGNIPLSFGNLSYLNKLILNNNLLTGQIPKSIKNLQKLTLLDLSYNSLSGEIPQELGQVTSLTINLDLSYNTFTGNIPETFSDLTQLQSLDLSSNSLHGDIKV-LGSLTSLASLNISCNNFSGPIPST 663          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y2317_ARATH (Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.308e-28
Identity = 86/271 (31.73%), Postives = 121/271 (44.65%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTG-------------------NPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +A +G IP  IGN   LE + L NN                    + +  L+G                   N L G LP S+GNL+  L T   G    SGNIP  IG               +G +P   G L KLQ + L  NK  G  P ++ +L  L+ L L+GN L G IPS + N+ SL+ LYL  N+    IP     L  ++  DFS N L G +  ++  +  L  + L +N L+G +P  +  L++L  +DL+ N L GP
Sbjct:  119 NALTGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLGNLN-KLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPKDIGNLTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGP 388          

HSP 2 Score: 124.79 bits (312), Expect = 6.933e-28
Identity = 80/253 (31.62%), Postives = 123/253 (48.62%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            + +  +G +P ++GNL  L     G N                 C  L+ +GL  N ++G LP  IG L + L+ + +     SG IP+ IG                GPIP+  G ++ L+ LYL  N+L G+ P EL  L ++ ++    N LSG IP  LS ++ LR LYL  N+ T +IP+    L+++   D S N L GP+     NL  +  + L  N+LSG +P  +G    L ++D + N+L G
Sbjct:  189 YTNNLTGPLPRSLGNLNKLTTFRAGQN-----DFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGML-VKLQEVILWQNKFSGFIPKDIGNLTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSENQLSG 435          

HSP 3 Score: 124.02 bits (310), Expect = 1.183e-27
Identity = 80/248 (32.26%), Postives = 119/248 (47.98%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IPN +  LRNL  L L  N                N   +R + L  N L+G++P  +G L   L  +      +SG IP  I                 G IP    R + L  L +  N+L G FP ELC L  L  + L  N+ SG +P  +     L+ L+L +N+F+S +P+    L +++ F+ SSN L GP+ S+I N K+L  ++LS N+  G +P  +G L  L+I+ L+ NR  G
Sbjct:  362 TGIIPNELSKLRNLAKLDLSIN-----SLTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLG-LYSPLWVVDFSENQLSGKIPPFICQQSNLILLNLGSNRIFGNIPPGVLRCKSLLQLRVVGNRLTGQFPTELCKLVNLSAIELDQNRFSGPLPPEIGTCQKLQRLHLAANQFSSNLPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILRLSENRFSG 603          

HSP 4 Score: 120.939 bits (302), Expect = 1.001e-26
Identity = 88/268 (32.84%), Postives = 117/268 (43.66%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXX-------------------ANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP  IG   NL+ LGL  N+                                  N   L  + L GN L G +PS IGN+  SLK LY+    ++G IP+ +G               +G IP    ++ +L+ LYL  NKL G  P+EL  L  L KL L  N L+G IP    NLTS+R L L  N  + VIP        +   DFS N L G +   I     L+ +NL  N + G++P  +   K L  + +  NRL G
Sbjct:  217 FSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPKDIGNLTSLETLALYGNSLVGPIPSEIGNMK-SLKKLYLYQNQLNGTIPKELGKLSKVMEIDFSENLLSGEIPVELSKISELRLLYLFQNKLTGIIPNELSKLRNLAKLDLSINSLTGPIPPGFQNLTSMRQLQLFHNSLSGVIPQGLGLYSPLWVVDFSENQLSGKIPPFICQQSNLILLNLGSNRIFGNIPPGVLRCKSLLQLRVVGNRLTG 483          

HSP 5 Score: 111.309 bits (277), Expect = 7.932e-24
Identity = 82/272 (30.15%), Postives = 117/272 (43.01%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNL-----------------------SMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDI-LFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP  I    NL  L LG+N                 CK L  + + GN L G  P+ +  L                          L+ L++     S N+P  I                TGPIP+     + LQ L L+ N  +GS P EL  L +L+ L L  N+ SG+IP  + NLT L  L +G N F+  IP     L  + +  + S N   G +  +IGNL +L+ ++L+ N+LSG++P T   L  L   + +YN L G
Sbjct:  434 SGKIPPFICQQSNLILLNLGSN-----RIFGNIPPGVLRCKSLLQLRVVGNRLTGQFPTELCKLVNLSAIELDQNRFSGPLPPEIGTCQKLQRLHLAANQFSSNLPNEISKLSNLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGEIPPEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNNLTG 700          

HSP 6 Score: 97.8265 bits (242), Expect = 9.076e-20
Identity = 63/191 (32.98%), Postives = 98/191 (51.31%), Query Frame = 2
Query:  134 CKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPAT 703
            C+KL+ + L  N  +  LP+ I  LS +L T  + + S++G IP  I                 G +P   G L +L+ L L+ N+  G+ P  + +L  L +L + GN  SGSIP  L  L+SL+ ++ L  N F+  IP    +L  +++   ++N L G + +   NL  LLG N S NNL+G +P T
Sbjct:  516 CQKLQRLHLAANQFSSNLPNEISKLS-NLVTFNVSSNSLTGPIPSEIANCKMLQRLDLSRNSFIGSLPPELGSLHQLEILRLSENRFSGNIPFTIGNLTHLTELQMGGNLFSGSIPPQLGLLSSLQIAMNLSYNDFSGEIPPEIGNLHLLMYLSLNNNHLSGEIPTTFENLSSLLGCNFSYNNLTGQLPHT 705          

HSP 7 Score: 95.5153 bits (236), Expect = 4.504e-19
Identity = 74/248 (29.84%), Postives = 103/248 (41.53%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG +  +IG L NL +L L  N                NC KL  + L  N   G +P  I  LS  L++  I N  +SG +P+ IG               TGP+P + G L KL       N   G+ P E+     L  L L  N +SG +P  +  L  L+ + L  N+F+  IP                         DIGNL  L  + L  N+L G +P+ IG +K L+ + L  N+L G
Sbjct:   98 SGIVSPSIGGLVNLVYLNLAYN-----ALTGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQ-LRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLGNLNKLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSGFIPK------------------------DIGNLTSLETLALYGNSLVGPIPSEIGNMKSLKKLYLYQNQLNG 315          

HSP 8 Score: 87.0409 bits (214), Expect = 9.398e-17
Identity = 62/208 (29.81%), Postives = 99/208 (47.60%), Query Frame = 2
Query:  155 GLTGNPLN--GILPSSIGNLSMS----LKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G+   P N  G+  SS G+ S S    + +L + + ++SG +  SIG               TG IP   G   KL+ ++L  N+  GS P E+  L +L    +  NKLSG +P  + +L +L  L   +N  T  +P +  +L  +  F    N   G + ++IG    L  + L++N +SG++P  IG L  LQ + L  N+  G
Sbjct:   60 GIDETPCNWIGVNCSSQGSSSSSNSLVVTSLDLSSMNLSGIVSPSIGGLVNLVYLNLAYNALTGDIPREIGNCSKLEVMFLNNNQFGGSIPVEINKLSQLRSFNICNNKLSGPLPEEIGDLYNLEELVAYTNNLTGPLPRSLGNLNKLTTFRAGQNDFSGNIPTEIGKCLNLKLLGLAQNFISGELPKEIGMLVKLQEVILWQNKFSG 267          

HSP 9 Score: 21.1718 bits (43), Expect = 9.398e-17
Identity = 9/27 (33.33%), Postives = 16/27 (59.26%), Query Frame = 1
Query:  805 NLSNIKSPGLFQNPWGTLLPREVISLS 885
            N+ ++K   L+QN     +P+E+  LS
Sbjct:  299 NMKSLKKLYLYQNQLNGTIPKELGKLS 325          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: RCH1_ARATH (LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 5.308e-28
Identity = 86/247 (34.82%), Postives = 117/247 (47.37%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP  IG +++L  + L  NY               N   L+++ L+ N + G +PS + N +  L    I    ISG IP  IG                G IP      Q LQ L L+ N L GS P  L  L  L KL+L  N +SG IP  + N TSL  L L +NR T  IP     L+++ F D S N L GP+  +I N + L  +NLS N L G +P ++  L  LQ++D++ N L G
Sbjct:  313 GPIPEEIGFMKSLNAIDLSMNYFSGTIPKSF-----GNLSNLQELMLSSNNITGSIPSILSNCT-KLVQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTG 553          

HSP 2 Score: 114.775 bits (286), Expect = 7.175e-25
Identity = 72/252 (28.57%), Postives = 115/252 (45.63%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +++  G IP+++G L+NL+ L L +N                +C  L+++ +  N L+  LP  +G +S        GN  +SG IP+ IG               +G +P + G+L KLQ L +    L G  P EL +   L  L L+ N LSG++P  L  L +L  + L  N     IP     +K +   D S N+  G +    GNL  L  + LS NN++G +P+ +     L    +  N++ G
Sbjct:  139 SNSLVGEIPSSLGKLKNLQELCLNSN-----GLTGKIPPELGDCVSLKNLEIFDNYLSENLPLELGKISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSNCTKLVQFQIDANQISG 385          

HSP 3 Score: 114.775 bits (286), Expect = 7.175e-25
Identity = 83/300 (27.67%), Postives = 127/300 (42.33%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFF------------------------DFSSNFLVGPLSS------------------------DIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            S  SG IP  IGN RNL+ LGL                      KL+ + +    L+G +P  +GN S  L  L++ +  +SG +P+ +G                GPIP   G ++ L  + L+ N   G+ P    +L  L +L+L  N ++GSIPS LSN T L    + +N+ + +IP     LK++  F                        D S N+L G L +                        +IGN   L+ + L  N ++G++P  IG L++L  +DL+ N L GP
Sbjct:  213 SELSGKIPEEIGNCRNLKVLGLAAT-----KISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCS-ELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSNCTKLVQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGP 506          

HSP 4 Score: 112.079 bits (279), Expect = 4.650e-24
Identity = 87/254 (34.25%), Postives = 122/254 (48.03%), Query Frame = 2
Query:    5 ASAFSGFIPNTIGNLRNLE-WLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQI-MDLAYNRLEG 760
            A+  SG IP  IG L+ L  +LG  N                A C+ L+ + L+ N L G LP+ +  L    K L I N +ISG IP  IG               TG IP   G LQ L  L L+ N L G  P E+ +  +L  L L  N L G +P  LS+LT L+ L + SN  T  IP +   L  +     S N   G + S +G+   L  ++LS NN+SG +P  +  ++DL I ++L++N L+G
Sbjct:  380 ANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDEL------AGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISN-AISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISGTIPEELFDIQDLDIALNLSWNSLDG 626          

HSP 5 Score: 110.538 bits (275), Expect = 1.353e-23
Identity = 79/254 (31.10%), Postives = 122/254 (48.03%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNP-LNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +++  +G IP  +G+  +L+ L + +NY                   L  I   GN  L+G +P  IGN   +LK L +    ISG++P S+G               +G IP   G   +L  L+L  N L G+ P EL  L  L+K++L+ N L G IP  +  + SL ++ L  N F+  IP +F +L ++     SSN + G + S + N   L+   +  N +SG +P  IG LK+L I     N+LEG
Sbjct:  162 NSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPLEL-----GKISTLESIRAGGNSELSGKIPEEIGNCR-NLKVLGLAATKISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITGSIPSILSNCTKLVQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEG 409          

HSP 6 Score: 108.997 bits (271), Expect = 3.937e-23
Identity = 76/272 (27.94%), Postives = 121/272 (44.49%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLS-----------------------MSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            FSG IP + GNL NL+ L L +N               +NC KL    +  N ++G++P  IG L                         +L+ L +    ++G++P  +                +G IP   G    L  L L  N++ G  P  +  L  L  L L  N LSG +P  +SN   L+ L L +N     +P +  SL  +   D SSN L G +   +G+L  L  + LS+N+ +G++P+++G   +LQ++DL+ N + G
Sbjct:  335 FSGTIPKSFGNLSNLQELMLSSN-----NITGSIPSILSNCTKLVQFQIDANQISGLIPPEIGLLKELNIFLGWQNKLEGNIPDELAGCQNLQALDLSQNYLTGSLPAGLFQLRNLTKLLLISNAISGVIPLEIGNCTSLVRLRLVNNRITGEIPKGIGFLQNLSFLDLSENNLSGPVPLEISNCRQLQMLNLSNNTLQGYLPLSLSSLTKLQVLDVSSNDLTGKIPDSLGHLISLNRLILSKNSFNGEIPSSLGHCTNLQLLDLSSNNISG 601          

HSP 7 Score: 97.4413 bits (241), Expect = 1.185e-19
Identity = 72/234 (30.77%), Postives = 107/234 (45.73%), Query Frame = 2
Query:  131 NCKKLRDIGLTGNPLNGILPSSIGNLS-----------------------MSLKTLYIGNCSISGNIPQSIG-XXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +C +L  I L+ N L G +PSS+G L                        +SLK L I +  +S N+P  +G                +G IP   G  + L+ L LA  K+ GS P  L  L +L  L ++   LSG IP  L N + L +L+L  N  +  +P     L+++       N L GP+  +IG +K L  I+LS N  SG +P + G L +LQ + L+ N + G
Sbjct:  128 DCSELIVIDLSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPLELGKISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGPIPEEIGFMKSLNAIDLSMNYFSGTIPKSFGNLSNLQELMLSSNNITG 361          

HSP 8 Score: 89.7373 bits (221), Expect = 2.472e-17
Identity = 61/208 (29.33%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  143 LRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGN-KLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            L+ + ++   L G + S IG+ S  L  + + + S+ G IP S+G               TG IP   G    L+ L +  N L  + P EL  +  L+ +   GN +LSG IP  + N  +L+ L L + + +  +P +   L  +      S  L G +  ++GN   L+ + L +N+LSG +P  +G L++L+ M L  N L GP
Sbjct:  108 LQKLVISNTNLTGAISSEIGDCS-ELIVIDLSSNSLVGEIPSSLGKLKNLQELCLNSNGLTGKIPPELGDCVSLKNLEIFDNYLSENLPLELGKISTLESIRAGGNSELSGKIPEEIGNCRNLKVLGLAATKISGSLPVSLGQLSKLQSLSVYSTMLSGEIPKELGNCSELINLFLYDNDLSGTLPKELGKLQNLEKMLLWQNNLHGP 314          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4885_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3)

HSP 1 Score: 124.405 bits (311), Expect = 9.055e-28
Identity = 72/208 (34.62%), Postives = 113/208 (54.33%), Query Frame = 2
Query:  140 KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            KL    L+ N L G +P  +G+LS +L TL++    ++G+IP  IG               TGPIP++FG L KL  LYL  N L GS P E+ +L  L +L L  N L+G IPS   NL ++  L +  N+ +  IP    ++  +      +N L GP+ S +GN+K L  ++L  N L+G +P  +G ++ +  ++++ N+L GP
Sbjct:  143 KLEYFDLSINQLVGEIPPELGDLS-NLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGP 349          

HSP 2 Score: 123.635 bits (309), Expect = 1.545e-27
Identity = 82/247 (33.20%), Postives = 119/247 (48.18%), Query Frame = 2
Query:   20 GFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            G IP  +G+L NL+ L L  N                   K+ +I +  N L G +PSS GNL+  L  LY+   S+SG+IP  IG               TG IP++FG L+ +  L +  N+L G  P E+ ++  LD L L  NKL+G IPS L N+ +L  L+L  N+    IP     ++ ++  + S N L GP+    G L  L  + L +N LSG +P  I    +L ++ L  N   G
Sbjct:  156 GEIPPELGDLSNLDTLHLVEN-----KLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLT-KLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTG 396          

HSP 3 Score: 111.309 bits (277), Expect = 7.932e-24
Identity = 75/251 (29.88%), Postives = 112/251 (44.62%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ SG IP+ IGNL NL  L L  N                N K +  + +  N L+G +P  IGN++ +L TL +    ++G IP ++G                G IP   G ++ +  L ++ NKL G  PD    L  L+ L L  N+LSG IP  ++N T L  L L +N FT  +P T      +       N   GP+   + + K L+ +    N+ SGD+    G    L  +DL+ N   G
Sbjct:  224 NSLSGSIPSEIGNLPNLRELCLDRN-----NLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMT-ALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHG 468          

HSP 4 Score: 110.153 bits (274), Expect = 1.767e-23
Identity = 74/249 (29.72%), Postives = 122/249 (49.00%), Query Frame = 2
Query:   14 FSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            F+GF+P+TI     LE L L +N+               +CK L  +   GN  +G +  + G +  +L  + + N +  G +  +                 TG IP     + +L  L L+ N++ G  P+ + ++ R+ KL L GN+LSG IPS +  LT+L  L L SNRF+S IP T  +L  + + + S N L   +   +  L  L  ++LS N L G++ +    L++L+ +DL++N L G
Sbjct:  394 FTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLR-----DCKSLIRVRFKGNSFSGDISEAFG-VYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITGELPESISNINRISKLQLNGNRLSGKIPSGIRLLTNLEYLDLSSNRFSSEIPPTLNNLPRLYYMNLSRNDLDQTIPEGLTKLSQLQMLDLSYNQLDGEISSQFRSLQNLERLDLSHNNLSG 636          

HSP 5 Score: 106.686 bits (265), Expect = 1.954e-22
Identity = 77/249 (30.92%), Postives = 114/249 (45.78%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGP 763
            +G IP+ IG L  +  + + +N                N  KL ++ L  N L+G +PS IGNL  +L+ L +   +++G IP S G               +G IP   G +  L  L L  NKL G  P  L ++  L  L L+ N+L+GSIP  L  + S+  L +  N+ T  +P +F  L  + +     N L GP+   I N   L  + L  NN +G +P TI     L+ + L  N  EGP
Sbjct:  179 NGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSF-----GNLTKLVNLYLFINSLSGSIPSEIGNLP-NLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSGEIPPEIGNMTALDTLSLHTNKLTGPIPSTLGNIKTLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGP 421          

HSP 6 Score: 106.686 bits (265), Expect = 1.954e-22
Identity = 75/272 (27.57%), Postives = 120/272 (44.12%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKL------------------------VGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP++ GNL+N+  L +  N                N   L  + L  N L G +PS++GN+  +L  L++    ++G+IP  +G               TGP+P +FG+L  L+ L+L  N+L                         G  PD +C  G+L+ L L  N   G +P  L +  SL  +    N F+  I   F     + F D S+N   G LS++    + L+   LS N+++G +P  I  +  L  +DL+ NR+ G
Sbjct:  251 TGKIPSSFGNLKNVTLLNMFENQLSGEIPPEI-----GNMTALDTLSLHTNKLTGPIPSTLGNIK-TLAVLHLYLNQLNGSIPPELGEMESMIDLEISENKLTGPVPDSFGKLTALEWLFLRDNQLSGPIPPGIANSTELTVLQLDTNNFTGFLPDTICRGGKLENLTLDDNHFEGPVPKSLRDCKSLIRVRFKGNSFSGDISEAFGVYPTLNFIDLSNNNFHGQLSANWEQSQKLVAFILSNNSITGAIPPEIWNMTQLSQLDLSSNRITG 516          

HSP 7 Score: 101.293 bits (251), Expect = 8.209e-21
Identity = 57/146 (39.04%), Postives = 85/146 (58.22%), Query Frame = 2
Query:  323 TGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G I   +GR  KL+   L+ N+LVG  P EL  L  LD L L  NKL+GSIPS +  LT +  + +  N  T  IPS+F +L  ++      N L G + S+IGNL  L  + L  NNL+G +P++ G LK++ ++++  N+L G
Sbjct:  131 SGTISPLWGRFSKLEYFDLSINQLVGEIPPELGDLSNLDTLHLVENKLNGSIPSEIGRLTKVTEIAIYDNLLTGPIPSSFGNLTKLVNLYLFINSLSGSIPSEIGNLPNLRELCLDRNNLTGKIPSSFGNLKNVTLLNMFENQLSG 276          
BLAST of EY659338 vs. ExPASy Swiss-Prot
Match: Y4265_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 9.055e-28
Identity = 80/275 (29.09%), Postives = 135/275 (49.09%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFS------------------------SNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ SG +P +IGNL+ ++ + +  +                 C +L+++ L  N ++G +P++IG L   L++L +   ++ G IP  +G               TG IP +FG+L+ LQ L L+ N++ G+ P+EL +  +L  L +  N ++G IPS +SNL SL   +   N+ T  IP +    +++   D S                        SN L G +  DIGN   L  + L+ N L+G +P+ IG LK+L  +D++ NRL G
Sbjct:  224 TSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGY-----CTELQNLYLYQNSISGSIPTTIGGLK-KLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVG 492          

HSP 2 Score: 120.553 bits (301), Expect = 1.308e-26
Identity = 84/256 (32.81%), Postives = 118/256 (46.09%), Query Frame = 2
Query:    2 HASAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEGPXL 769
            + ++ SG IP TIG L+ L+ L L  N                NC +L  I  + N L G +P S G L  +L+ L +    ISG IP+ +                TG IP+    L+ L   +   NKL G+ P  L     L  + L  N LSGSIP  +  L +L  L L SN  +  IP    +  ++     + N L G + S+IGNLK L  +++SEN L G +P  I G + L+ +DL  N L G  L
Sbjct:  270 YQNSISGSIPTTIGGLKKLQSLLLWQN-----NLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLE-NLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLL 519          

HSP 3 Score: 110.923 bits (276), Expect = 1.036e-23
Identity = 77/272 (28.31%), Postives = 117/272 (43.01%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSM--------------------SLKTLYI----GNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP  IG+   LE L L +N                  KKL+ + L  N L G +P  IGNLS                      LK L +    GN ++ G +P  IG               +G +P + G L+++Q + +  + L G  PDE+ +   L  L L+ N +SGSIP+ +  L  L+SL L  N     IP+   +  ++   DFS N L G +    G L+ L  + LS N +SG +P  +     L  +++  N + G
Sbjct:  106 TGVIPKEIGDFTELELLDLSDNSLSGDIPVEIF-----RLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITG 372          

HSP 4 Score: 109.768 bits (273), Expect = 2.308e-23
Identity = 84/271 (31.00%), Postives = 118/271 (43.54%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNRFTSVIPST--------FWSL---------------KDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            +G IP + G L NL+ L L  N                NC KL  + +  N + G +PS + NL  SL   +     ++GNIPQS+                +G IP     L+ L  L L  N L G  P ++ +   L +L L GN+L+GSIPS + NL +L  + +  NR    IP          F  L               K + F DFS N L   L   IG L  L  +NL++N LSG++P  I   + LQ+++L  N   G
Sbjct:  323 TGTIPRSFGKLENLQELQLSVNQISGTIPEEL-----TNCTKLTHLEIDNNLITGEIPSLMSNLR-SLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSG 587          

HSP 5 Score: 104.76 bits (260), Expect = 7.425e-22
Identity = 80/272 (29.41%), Postives = 117/272 (43.01%), Query Frame = 2
Query:   17 SGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSN------------------------LTSLRSLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            SG IP +IG L+NL+ L  G N                  K LR          G LP  IGN   +L  L +   S+SG +P SIG               +GPIP   G   +LQ LYL  N + GS P  +  L +L  L+L+ N L G IP+ L N                        L +L+ L L  N+ +  IP    +   +   +  +N + G + S + NL+ L      +N L+G++P ++   ++LQ +DL+YN L G
Sbjct:  178 SGEIPRSIGELKNLQVLRAGGN------------------KNLR----------GELPWEIGNCE-NLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSG 420          

HSP 6 Score: 102.834 bits (255), Expect = 2.821e-21
Identity = 72/232 (31.03%), Postives = 110/232 (47.41%), Query Frame = 2
Query:  140 KLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPIPTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLRSLYLGSNR-------------------------FTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNRLEG 760
            ++ +I L G  L G LP +      SL +L + + +++G IP+ IG               +G IP    RL+KL+ L L  N L G  P E+ +L  L +L+LF NKLSG IP  +  L +L+ L  G N+                          +  +P++  +LK +      ++ L GP+  +IG    L  + L +N++SG +P TIGGLK LQ + L  N L G
Sbjct:   69 EVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVG 300          

HSP 7 Score: 97.8265 bits (242), Expect = 9.076e-20
Identity = 90/272 (33.09%), Postives = 119/272 (43.75%), Query Frame = 2
Query:    8 SAFSGFIPNTIGNLRNLEWLGLGNNYXXXXXXXXXXXXXXANCKKLRDIGLTGNPLNGILPSSIGNLSMSLKTLYIGNCSISGNIPQSIGXXXXXXXXXXXXXXXTGPI-----------------------PTTFGRLQKLQGLYLAFNKLVGSFPDELCHLGRLDKLVLFGNKLSGSIPSCLSNLTSLR-SLYLGSNRFTSVIPSTFWSLKDILFFDFSSNFLVGPLSSDIGNLKVLLGINLSENNLSGDMPATIGGLKDLQIMDLAYNR 751
            ++ SG IP  I  LRNL  L L +N                NC  L  + L GN L G +PS IGNL  +L  + I    + G+IP +I                +G +                       P   G L +L  L LA N+L G  P E+     L  L L  N  SG IP  L  + SL  SL L  NRF   IPS F  LK++   D S N L G L+  + +L+ L+ +N+S N+ SGD+P T    + L + DLA NR
Sbjct:  416 NSLSGSIPKEIFGLRNLTKLLLLSN-----DLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLK-NLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNV-LTDLQNLVSLNISYNDFSGDLPNT-PFFRRLPLSDLASNR 679          
The following BLAST results are available for this feature:
BLAST of EY659338 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 91
Match NameE-valueIdentityDescription
EFR_ARATH4.055e-3634.62LRR receptor-like serine/threonine-protein kinase ... [more]
RCH2_ARATH6.060e-3236.10Receptor-like protein kinase 2 OS=Arabidopsis thal... [more]
Y1571_ARATH3.007e-3131.99Probable leucine-rich repeat receptor-like protein... [more]
Y3475_ARATH3.928e-3134.50Probable LRR receptor-like serine/threonine-protei... [more]
FLS2_ARATH8.750e-3135.06LRR receptor-like serine/threonine-protein kinase ... [more]
Y1341_ARATH1.397e-2834.13Probable LRR receptor-like serine/threonine-protei... [more]
Y2317_ARATH5.308e-2831.73Probable leucine-rich repeat receptor-like protein... [more]
RCH1_ARATH5.308e-2834.82LRR receptor-like serine/threonine-protein kinase ... [more]
Y4885_ARATH9.055e-2834.62Probable LRR receptor-like serine/threonine-protei... [more]
Y4265_ARATH9.055e-2829.09Probable LRR receptor-like serine/threonine-protei... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-002-A11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659338 ID=EY659338|Name=EY659338|organism=Citrus sinensis|type=EST|length=918bp
CCACGCGTCCGCATTTTCGGGATTTATTCCAAACACAATTGGTAATTTAA
GAAACCTTGAGTGGCTCGGCTTGGGTAATAACTACTTGACATCTTCAACC
TCAAAATTGAGCTTTCTTTCCTCTTTGGCAAATTGCAAGAAATTAAGAGA
CATAGGCTTAACAGGCAATCCACTCAACGGTATCCTTCCAAGTTCAATAG
GTAATCTTTCCATGTCTTTGAAAACACTTTACATCGGCAATTGCAGTATT
AGTGGCAACATTCCTCAATCAATTGGCAATTTAAGCAACTTATTGGCCTT
AGTATTAGAACTCAATAAATTGACTGGACCTATCCCAACTACATTCGGCC
GACTGCAGAAACTCCAAGGCTTATATCTTGCATTCAATAAGTTGGTAGGT
TCATTCCCAGATGAGCTTTGCCATCTAGGAAGGCTGGATAAATTGGTCTT
ATTTGGCAATAAGCTTTCAGGATCTATACCTTCATGCTTAAGTAATCTCA
CTTCTCTGAGATCTCTCTACTTAGGGTCCAATAGGTTTACTTCTGTCATT
CCCTCAACTTTCTGGAGCCTAAAAGACATCTTGTTCTTTGACTTTTCATC
AAATTTCTTGGTGGGTCCTCTTTCTTCAGACATAGGTAATTTGAAGGTGC
TTCTAGGAATAAATTTATCAGAAAATAACTTATCGGGTGATATGCCAGCC
ACAATTGGAGGACTGAAAGATCTTCAAATTATGGACCTAGCATATAATAG
ATTGGAAGGCCCANTNCTGNANNTCATTGTGACTTTGATAGTTTAGAAAG
TTTGAATTTGTCAAATATAAAATCTCCGGGTCTATTCCAAAATCCNTGGG
GAACTCTTTTACCTCGAGAAGTAATCTCTCTTTCATGAACTAGAAGTGAG
ATTCTAGTGGAGAATTTT
back to top