EY659283

Overview
NameEY659283
Unique NameEY659283
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length813
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659283 vs. ExPASy Swiss-Prot
Match: ODBB_DICDI (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Dictyostelium discoideum GN=bkdB PE=3 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.256e-15
Identity = 39/100 (39.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query:  440 TEQSRYGAERHGGHYQLTVPESTLWHAPVMIGVIPRTQPQAIR*SLICILDPYHVALY*HGWPDRTAVKQVPGDDYLMTLSNAHVTHESIDITLVSMGAQ 739
            T +S YGA  HGGHY    PES   H P +  VIP T  +A    L  I +   V  +      R+AV++VP  DY + L  A +  E  DIT++  GAQ
Sbjct:  159 TIRSPYGAVGHGGHYHSQSPESYFGHTPGLKVVIPSTPIEAKGLLLASIREKDPVIFFEPKLMYRSAVEEVPIGDYEIPLGKARIVKEGKDITIIGWGAQ 258          

HSP 2 Score: 32.3426 bits (72), Expect = 1.256e-15
Identity = 17/50 (34.00%), Postives = 30/50 (60.00%), Query Frame = 1
Query:  241 GQNQGWSSLLIEHMISEPSIGITTMGDLTIGEMEYGYHIIPAPDLIVNES 390
            G ++ +++ L E  I+  +IG+   G   I E+++  +I PA D IVNE+
Sbjct:   93 GASRVFNTPLCEQGIAGFAIGLAAQGATPIAEIQFADYIFPAFDQIVNEA 142          

HSP 3 Score: 29.6462 bits (65), Expect = 1.256e-15
Identity = 16/51 (31.37%), Postives = 27/51 (52.94%), Query Frame = 3
Query:   87 DVGKDNYINSFSDMNRTLHIDEETDTLAYV*GKYVHSVGVFLCTICTLDRH 239
            + G+   +N F  +N  + I  + D+ A V G+ V   GVF CT+   D++
Sbjct:   42 NAGEKQKMNLFQAINNGMDIAMQKDSKAVVFGEDVGFGGVFRCTVGLRDKY 92          
BLAST of EY659283 vs. ExPASy Swiss-Prot
Match: ODBB_BOVIN (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Bos taurus GN=BCKDHB PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 1.685e-12
Identity = 38/112 (33.93%), Postives = 55/112 (49.11%), Query Frame = 2
Query:  440 TEQSRYGAERHGGHYQLTVPESTLWHAPVMIGVIPRTQPQAIR*SLICILDPYHVALY*HGWPDRTAVKQVPGDDYLMTLSNAHVTHESIDITLVSMGAQHYMMKHDCLYAE 775
            T +S +G   HG  Y    PE+   H P +  V+PR+  QA    L CI D      +      R AV+QVP + Y + LS A V  E  D+TLV+ G Q ++++     A+
Sbjct:  181 TIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVVPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIREVAAMAQ 292          

HSP 2 Score: 32.3426 bits (72), Expect = 1.685e-12
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  241 GQNQGWSSLLIEHMISEPSIGITTMGDLTIGEMEYGYHIIPAPDLIVNES 390
            G+++ +++ L E  I    IGI   G   I E+++  +I PA D IVNE+
Sbjct:  115 GKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEA 164          

HSP 3 Score: 24.2534 bits (51), Expect = 1.685e-12
Identity = 14/51 (27.45%), Postives = 23/51 (45.10%), Query Frame = 3
Query:   87 DVGKDNYINSFSDMNRTLHIDEETDTLAYV*GKYVHSVGVFLCTICTLDRH 239
            + G+   +N F  +   L      D  A + G+ V   GVF CT+   D++
Sbjct:   64 EYGQTQKMNLFQAVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKY 114          
BLAST of EY659283 vs. ExPASy Swiss-Prot
Match: ODBB_RAT (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Rattus norvegicus GN=Bckdhb PE=1 SV=3)

HSP 1 Score: 55.4546 bits (132), Expect = 2.177e-12
Identity = 37/105 (35.24%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  440 TEQSRYGAERHGGHYQLTVPESTLWHAPVMIGVIPRTQPQAIR*SLICILDPYHVALY*HGWPDRTAVKQVPGDDYLMTLSNAHVTHESIDITLVSMGAQHYMMK 754
            T ++ +G   HG  Y    PE+   H P +  VIPR+  QA    L CI D      +      R AV+QVP + Y + LS A V  E  D+TLV+ G Q ++++
Sbjct:  179 TIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIR 283          

HSP 2 Score: 32.3426 bits (72), Expect = 2.177e-12
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  241 GQNQGWSSLLIEHMISEPSIGITTMGDLTIGEMEYGYHIIPAPDLIVNES 390
            G+++ +++ L E  I    IGI   G   I E+++  +I PA D IVNE+
Sbjct:  113 GKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEA 162          

HSP 3 Score: 24.6386 bits (52), Expect = 2.177e-12
Identity = 14/49 (28.57%), Postives = 22/49 (44.90%), Query Frame = 3
Query:   93 GKDNYINSFSDMNRTLHIDEETDTLAYV*GKYVHSVGVFLCTICTLDRH 239
            G+   +N F  +   L      D  A + G+ V   GVF CT+   D++
Sbjct:   64 GQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKY 112          
BLAST of EY659283 vs. ExPASy Swiss-Prot
Match: ODBB_MOUSE (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Mus musculus GN=Bckdhb PE=2 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 2.177e-12
Identity = 37/105 (35.24%), Postives = 53/105 (50.48%), Query Frame = 2
Query:  440 TEQSRYGAERHGGHYQLTVPESTLWHAPVMIGVIPRTQPQAIR*SLICILDPYHVALY*HGWPDRTAVKQVPGDDYLMTLSNAHVTHESIDITLVSMGAQHYMMK 754
            T ++ +G   HG  Y    PE+   H P +  VIPR+  QA    L CI D      +      R AV+QVP + Y + LS A V  E  D+TLV+ G Q ++++
Sbjct:  179 TIRAPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAVEQVPVEPYKIPLSQAEVIQEGSDVTLVAWGTQVHVIR 283          

HSP 2 Score: 32.3426 bits (72), Expect = 2.177e-12
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  241 GQNQGWSSLLIEHMISEPSIGITTMGDLTIGEMEYGYHIIPAPDLIVNES 390
            G+++ +++ L E  I    IGI   G   I E+++  +I PA D IVNE+
Sbjct:  113 GKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEA 162          

HSP 3 Score: 24.6386 bits (52), Expect = 2.177e-12
Identity = 14/49 (28.57%), Postives = 22/49 (44.90%), Query Frame = 3
Query:   93 GKDNYINSFSDMNRTLHIDEETDTLAYV*GKYVHSVGVFLCTICTLDRH 239
            G+   +N F  +   L      D  A + G+ V   GVF CT+   D++
Sbjct:   64 GQTQKMNLFQSITSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKY 112          
BLAST of EY659283 vs. ExPASy Swiss-Prot
Match: ODBB_HUMAN (2-oxoisovalerate dehydrogenase subunit beta, mitochondrial OS=Homo sapiens GN=BCKDHB PE=1 SV=2)

HSP 1 Score: 53.1434 bits (126), Expect = 2.177e-12
Identity = 36/105 (34.29%), Postives = 52/105 (49.52%), Query Frame = 2
Query:  440 TEQSRYGAERHGGHYQLTVPESTLWHAPVMIGVIPRTQPQAIR*SLICILDPYHVALY*HGWPDRTAVKQVPGDDYLMTLSNAHVTHESIDITLVSMGAQHYMMK 754
            T +S +G   HG  Y    PE+   H P +  VIPR+  QA    L CI D      +      R A ++VP + Y + LS A V  E  D+TLV+ G Q ++++
Sbjct:  181 TIRSPWGCVGHGALYHSQSPEAFFAHCPGIKVVIPRSPFQAKGLLLSCIEDKNPCIFFEPKILYRAAAEEVPIEPYNIPLSQAEVIQEGSDVTLVAWGTQVHVIR 285          

HSP 2 Score: 32.3426 bits (72), Expect = 2.177e-12
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = 1
Query:  241 GQNQGWSSLLIEHMISEPSIGITTMGDLTIGEMEYGYHIIPAPDLIVNES 390
            G+++ +++ L E  I    IGI   G   I E+++  +I PA D IVNE+
Sbjct:  115 GKDRVFNTPLCEQGIVGFGIGIAVTGATAIAEIQFADYIFPAFDQIVNEA 164          

HSP 3 Score: 26.9498 bits (58), Expect = 2.177e-12
Identity = 15/52 (28.85%), Postives = 24/52 (46.15%), Query Frame = 3
Query:   84 RDVGKDNYINSFSDMNRTLHIDEETDTLAYV*GKYVHSVGVFLCTICTLDRH 239
            R+ G+   +N F  +   L      D  A + G+ V   GVF CT+   D++
Sbjct:   63 REYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRDKY 114          
The following BLAST results are available for this feature:
BLAST of EY659283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ODBB_DICDI1.256e-1539.002-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_BOVIN1.685e-1233.932-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_RAT2.177e-1235.242-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_MOUSE2.177e-1235.242-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
ODBB_HUMAN2.177e-1234.292-oxoisovalerate dehydrogenase subunit beta, mitoc... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659283 ID=EY659283|Name=EY659283|organism=Citrus sinensis|type=EST|length=813bp
CCACGCGTCCGGTTGAGGTTTCCATTCACACGCATAATCTTTCAACTGCT
TGTGCAAACAATCTTGTATTTCAACAACACAATCGGGATGTTGGCAAAGA
CAACTATATTAATTCGTTCTCTGACATGAACCGAACTTTGCATATCGATG
AGGAAACTGATACACTTGCCTATGTGTAAGGAAAATATGTACACTCTGTT
GGAGTCTTCCTATGCACAATATGTACACTTGATCGACACAGGTCAAAATC
AGGGATGGAGTTCCCTTCTTATTGAACACATGATCTCTGAACCATCCATA
GGCATAACGACTATGGGAGATTTAACTATCGGTGAGATGGAATATGGATA
TCATATTATTCCAGCTCCTGATCTTATTGTCAATGAATCTGATAACCCCA
GAAGCATACAAAGGAACTGAATGTACTTGAGCATGATGAACAGAGCAATC
CCGTTACGGAGCTGAGCGCCATGGTGGACACTATCAGCTCACAGTCCCTG
AATCTACACTGTGGCACGCCCCTGTCATGATAGGGGTGATACCTAGAACC
CAACCACAAGCAATACGATGATCGCTTATATGCATTCTTGATCCCTACCA
TGTAGCACTTTACTGACACGGATGGCCTGACCGTACCGCTGTAAAACAAG
TTCCTGGAGACGATTATCTGATGACTTTATCAAATGCTCACGTGACACAT
GAAAGCATTGACATAACACTCGTTAGTATGGGAGCGCAACACTATATGAT
GAAGCATGACTGTCTATACGCTGAATAGGAATGAATTATTAGTGACTGAT
CTTCCTGAGACAC
back to top