EY659279

Overview
NameEY659279
Unique NameEY659279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length772
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659279 vs. ExPASy Swiss-Prot
Match: Y4105_ARATH (Uncharacterized protein At4g01050 OS=Arabidopsis thaliana GN=At4g01050 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 1.088e-33
Identity = 93/191 (48.69%), Postives = 109/191 (57.07%), Query Frame = 2
Query:   50 FAKSVHGGLMLLSSFLG--TGLAQALTYE*ALQDXXXXXXXDVYASGFIDSVMRLGTDNSLSIAGGGTILAVPLVLSQVLNK-PKSWGVESRRNAYAKLGDDASAHLLDIRAAVAFQPVSNTDGPSSWKRPASIVYKSDH*PGFLNNLSLKVTESYNTTLRILHIHDGNSQLAAESGPYMGLKMHTLYKMG 613
            F K  +GGL LL+S L   T  A++LTYE ALQ           + G I+ +    TDN L IAGG   LAVP VLSQVLNK PKSWGVES +NAY KLG D +A LLDIRA   F+ V + +     K+  S VY  +  PGFL  LSLK  +  NTTL IL   DGNS+L AE     G K     K G
Sbjct:   45 FLKRFNGGLALLTSVLSSATAPAKSLTYEEALQQSMTTSS-SFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLSQVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGFLKKLSLKFKDPENTTLYILDKFDGNSELVAELVALNGFKSAYAIKDG 234          
The following BLAST results are available for this feature:
BLAST of EY659279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4105_ARATH1.088e-3348.69Uncharacterized protein At4g01050 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-D04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659279 ID=EY659279|Name=EY659279|organism=Citrus sinensis|type=EST|length=772bp
AGCAACTTCTGCTTCTAATAAAACCACCCAACACAATTTTCTATAGTGTT
TTGCAAAGAGTGTGCATGGCGGTTTAATGCTGTTATCTTCATTTCTTGGT
ACTGGTTTAGCTCAAGCTTTAACATATGAATAAGCGCTGCAGGATTCAGG
AAGCTCTTCATCATCTGATGTTTATGCAAGTGGATTTATTGACAGCGTAA
TGAGGCTTGGAACAGATAATTCTTTATCTATAGCTGGAGGTGGCACCATT
TTGGCTGTTCCATTAGTTTTGTCTCAGGTTCTGAACAAGCCTAAATCATG
GGGTGTTGAGTCTCGTAGGAATGCTTATGCAAAGTTGGGTGACGATGCCA
GTGCCCATTTGCTTGATATAAGAGCTGCCGTGGCATTCCAGCCTGTCAGT
AATACTGATGGCCCGAGTTCGTGGAAGAGGCCGGCTTCTATTGTTTACAA
AAGTGACCATTAGCCGGGCTTCTTGAATAATCTGTCTCTGAAGGTTACGG
AATCCTACAATACTACATTGCGGATTCTACACATACATGATGGGAACTCT
CAACTGGCTGCTGAGTCGGGACCATATATGGGTTTAAAAATGCATACACT
ATATAAGATGGGTCAGTATGACCTCTGGCATGGATGATCAGTGGTCATCG
CTGGATATCCGCACATATACATTGGGACTTGAGCTGAGCTATACGACATT
AACTCTCATTAGTGCATTAGGAGACGGCTCGTGAGGCTTTGCTGGTCCCA
TGCATTGCTGCATTGCATGATT
back to top