EY659273

Overview
NameEY659273
Unique NameEY659273
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length851
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659273_ssr18 microsatellite EY659273_ssr18:18..37. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: SF21_HELAN (Pollen-specific protein SF21 OS=Helianthus annuus GN=SF21 PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.447e-85
Identity = 150/228 (65.79%), Postives = 183/228 (80.26%), Query Frame = 3
Query:   42 MADSSSDSVSIDMETPPPSGKDNLIKTSHGSLSVTIYGDQDKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSKEVRGNAQVPESDIVQACRRLLDERQSSXCWHFLEAL 725
            MADS   S+S+   +    GK+++I+T  GS+SVT+ GDQ+KP L+TYPDLALN+MSCFQGLF  PE+ SLLLHNFCIYHINPPGHE GAA+I  D+PV S++DL DQI  VLN+F LG+VMCMG  AGAYILTLF++KY  RV GLIL+SP+CKAPSWTE  YNK+ S  LYYYGMC +VKELL+ RYFSKEV GN ++PESD+V ACR+LLDER S   W +L+A+
Sbjct:    1 MADSGH-SISVTFPSFHSGGKEHIIRTGCGSVSVTVCGDQEKPPLITYPDLALNHMSCFQGLFVSPESASLLLHNFCIYHINPPGHELGAASIGIDDPVPSIEDLCDQILVVLNYFRLGSVMCMGAMAGAYILTLFSIKYSERVTGLILISPICKAPSWTERFYNKLTSKTLYYYGMCDLVKELLIHRYFSKEVCGNPEIPESDMVLACRKLLDERDSVNVWRYLQAI 227          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_PANTR (Protein NDRG2 OS=Pan troglodytes GN=NDRG2 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.934e-23
Identity = 67/200 (33.50%), Postives = 108/200 (54.00%), Query Frame = 3
Query:   90 PPSGKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            P + K + ++T +GS++ T+YG     +PA++TY D+ LNY SCFQ LF   E    ++ NF   H++ PG E GA          S+D LAD I  VL +     ++ +GV AGAYIL  +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R ++
Sbjct:   21 PEAAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQF-EDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKRWMDWAAHKLT-------GLTSSIPEMILGHLFSQEELSGN-----SELIQKYRNII 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_MACFA (Protein NDRG2 OS=Macaca fascicularis GN=NDRG2 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.012e-22
Identity = 67/200 (33.50%), Postives = 109/200 (54.50%), Query Frame = 3
Query:   90 PPSGKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            P + K + ++T +GS++ T+YG     +PA++TY D+ LNY SCFQ LF   +   ++  NF   H++ PG E GA          S+D LAD I  VL +     V+ +GV AGAYIL+ +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R ++
Sbjct:   21 PEAAKIHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFGDMQEII-QNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTVIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSIPEMILGHLFSQEELSGN-----SELIQKYRNII 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_PONAB (Protein NDRG2 OS=Pongo abelii GN=NDRG2 PE=2 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 66/197 (33.50%), Postives = 107/197 (54.31%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            G+ + ++T +GS++ T+YG     +PA++TY D+ LNY SCFQ LF   E    ++ NF   H++ PG E GA          S+D LAD I  VL +     ++ +GV AGAYIL  +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R ++
Sbjct:   38 GQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQF-EDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSIPEMILGHLFSQEELSGN-----SELIQKYRNII 221          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_HUMAN (Protein NDRG2 OS=Homo sapiens GN=NDRG2 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.726e-22
Identity = 66/197 (33.50%), Postives = 107/197 (54.31%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            G+ + ++T +GS++ T+YG     +PA++TY D+ LNY SCFQ LF   E    ++ NF   H++ PG E GA          S+D LAD I  VL +     ++ +GV AGAYIL  +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R ++
Sbjct:   38 GQTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQF-EDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSIPEMILGHLFSQEELSGN-----SELIQKYRNII 221          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_BOVIN (Protein NDRG2 OS=Bos taurus GN=NDRG2 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.255e-22
Identity = 64/200 (32.00%), Postives = 108/200 (54.00%), Query Frame = 3
Query:   90 PPSGKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            P   K + ++T +GS++ T+YG     +PA++TY D+ LNY SCFQ LF   +   ++  NF   H++ PG E GA          S+D LAD I  +L +     ++ +GV AGAY+L+ +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R ++
Sbjct:   21 PEVAKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFADMQEII-QNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGIGVGAGAYVLSRYALTHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSISEMILGHLFSQEELSGN-----SELIQKYRNII 207          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_RAT (Protein NDRG2 OS=Rattus norvegicus GN=Ndrg2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.119e-21
Identity = 65/197 (32.99%), Postives = 106/197 (53.81%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQVPESDIVQACRRLL 680
            G+ + ++T +GS++ T+YG     +PA+ TY D+ LNY SCFQ LF   +   ++  NF   H++ PG E GA          S D LAD I  +L +     ++ +GV AGAYIL+ +A+ +   V GL+L++    A  W +W  +K+        G+   + E++L   FS +E+ GN     S+++Q  R L+
Sbjct:   38 GQTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFQFGDMQEII-QNFVRVHVDAPGMEEGAPVFPLGYQYPSQDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSIPEMILGHLFSQEELSGN-----SELIQKYRSLI 221          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG2_MOUSE (Protein NDRG2 OS=Mus musculus GN=Ndrg2 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.493e-21
Identity = 60/184 (32.61%), Postives = 102/184 (55.43%), Query Frame = 3
Query:   99 GKDNLIKTSHGSLSVTIYGDQD--KPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFS-KEVRGNAQV 641
            G+ + ++T +GS++ T+YG     +PA+ TY D+ LNY SCFQ LF   +   ++  NF   H++ PG E GA          S+D LAD I  +L +     ++ +GV AGAYIL+ +A+ +   V GL+L++    A  W +W  +K+        G+   + +++L   FS +E+ GN+++
Sbjct:   38 GQTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFRFGDMQEII-QNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSRYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLT-------GLTSSIPDMILGHLFSQEELSGNSEL 213          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDR1A_XENLA (Protein NDRG1-A OS=Xenopus laevis GN=ndrg1-A PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.256e-21
Identity = 60/182 (32.97%), Postives = 99/182 (54.40%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQVPES 650
            I+T+HG + VT+ G    ++P ++TY D+ LN+ +CF  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  V+   GL  VM +G+ AGAYILT FA+ +   V GL+L++    A  W +W   K+        G    + ++++   FSK EV  N ++ E+
Sbjct:   38 IETAHGIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEISQH-FSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVVQQLGLRTVMGLGIGAGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKIS-------GWTNALPDMVISHLFSKDEVHSNPELVET 211          
BLAST of EY659273 vs. ExPASy Swiss-Prot
Match: NDRG1_XENTR (Protein NDRG1 OS=Xenopus tropicalis GN=ndrg1 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 7.253e-21
Identity = 59/182 (32.42%), Postives = 100/182 (54.95%), Query Frame = 3
Query:  114 IKTSHGSLSVTIYGDQ--DKPALVTYPDLALNYMSCFQGLFFCPEACSLLLHNFCIYHINPPGHEFGAAAISDDEPVLSVDDLADQIAEVLNHFGLGAVMCMGVTAGAYILTLFAMKYRHRVLGLILVSPLCKAPSWTEWLYNKVMSNLLYYYGMCGVVKELLLKRYFSK-EVRGNAQVPES 650
            I+T+HG + VT+ G    ++P ++TY D+ LN+ +CF  LF   +   +  H F + H++ PG + GAA+        S+D LA+ +  V+   GL +V+ +G+ AGAYILT FA+ +   V GL+L++    A  W +W   K+        G    + ++++   FSK EV  N ++ E+
Sbjct:   37 IETAHGIVHVTMCGTPKLNRPVILTYHDIGLNHKTCFNSLFNFEDMHEITQH-FSVCHVDAPGQQEGAASFPAGYMYPSMDQLAEMLPGVIQQLGLKSVLGLGIGAGAYILTRFALNHPSMVEGLVLININPCAEGWMDWAATKIS-------GWTHALPDMVISHLFSKDEVHSNHELVET 210          
The following BLAST results are available for this feature:
BLAST of EY659273 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
SF21_HELAN2.447e-8565.79Pollen-specific protein SF21 OS=Helianthus annuus ... [more]
NDRG2_PANTR5.934e-2333.50Protein NDRG2 OS=Pan troglodytes GN=NDRG2 PE=2 SV=... [more]
NDRG2_MACFA1.012e-2233.50Protein NDRG2 OS=Macaca fascicularis GN=NDRG2 PE=2... [more]
NDRG2_PONAB1.726e-2233.50Protein NDRG2 OS=Pongo abelii GN=NDRG2 PE=2 SV=2[more]
NDRG2_HUMAN1.726e-2233.50Protein NDRG2 OS=Homo sapiens GN=NDRG2 PE=1 SV=2[more]
NDRG2_BOVIN2.255e-2232.00Protein NDRG2 OS=Bos taurus GN=NDRG2 PE=2 SV=1[more]
NDRG2_RAT1.119e-2132.99Protein NDRG2 OS=Rattus norvegicus GN=Ndrg2 PE=1 S... [more]
NDRG2_MOUSE2.493e-2132.61Protein NDRG2 OS=Mus musculus GN=Ndrg2 PE=1 SV=1[more]
NDR1A_XENLA3.256e-2132.97Protein NDRG1-A OS=Xenopus laevis GN=ndrg1-A PE=2 ... [more]
NDRG1_XENTR7.253e-2132.42Protein NDRG1 OS=Xenopus tropicalis GN=ndrg1 PE=2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659273 ID=EY659273|Name=EY659273|organism=Citrus sinensis|type=EST|length=851bp
AGAAGAGTAGAGAGAGAAGAGAGAGAGAGAGAGAGAGAAAGATGGCAGAT
TCTTCAAGCGATTCGGTTTCCATTGATATGGAGACTCCTCCTCCTAGTGG
CAAGGACAATCTTATAAAAACTTCCCATGGTTCTTTGTCTGTTACCATCT
ATGGGGACCAGGACAAGCCAGCTCTTGTCACTTATCCTGATTTAGCTCTA
AACTATATGTCCTGCTTTCAAGGATTATTCTTCTGCCCAGAAGCATGTTC
CTTGCTACTGCACAACTTTTGCATATATCATATAAATCCTCCTGGCCACG
AGTTTGGAGCTGCGGCAATTAGTGATGATGAACCTGTACTCTCTGTTGAT
GATTTAGCGGATCAAATCGCTGAGGTTCTTAACCATTTTGGACTTGGTGC
AGTGATGTGTATGGGGGTTACAGCTGGAGCTTACATTCTTACACTATTTG
CTATGAAATATAGGCACCGTGTACTTGGGTTAATCCTAGTTTCTCCTCTG
TGCAAAGCACCCTCTTGGACAGAATGGTTGTATAATAAGGTAATGTCAAA
TTTACTCTACTACTATGGCATGTGTGGGGTGGTGAAGGAATTATTGCTAA
AGCGGTACTTCAGCAAGGAAGTTCGTGGTAATGCCCAAGTACCAGAATCT
GATATAGTTCAGGCATGCAGAAGACTGCTGGATGAAAGACAGAGCTCANN
ATGTTGGCATTTTCTTGAAGCATTAATGGGAGACCCGACATCAGCGAAGG
GNCTGCGGAACTGNCATGCCGCTCTCTAATATTGNTGGTGAAAGCTCTNC
TTNCATTNCTGAGCTGTCACATGACTTCTAAAATGATAGAAAAATANTGC
T
back to top