EY659272

Overview
NameEY659272
Unique NameEY659272
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length924
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659272_ssr76 microsatellite EY659272_ssr76:76..87. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_BACSU (Probable ATP-dependent DNA helicase recQ OS=Bacillus subtilis GN=recQ PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 5.850e-25
Identity = 47/117 (40.17%), Postives = 81/117 (69.23%), Query Frame = 1
Query:  433 LLRLVYGYDSFRDGQLEAIKMVLD-KKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQLRHLPPV-IHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            LL   +GY+ FR GQ EAI++V + +++T  ++PTG GKS+CYQIPA++  G T+V+ PL++LM DQ+  L    I+  +++S+Q  +E+ E +  ++ GA K+ +++PER  + +F
Sbjct:    8 LLAHYFGYEKFRSGQDEAIRLVTEARQNTACIMPTGGGKSICYQIPALMFEGTTIVISPLISLMKDQVDALEEAGINAAYINSTQSNQEIYERLNGLKEGAYKLFYITPERLTSIEF 124          

HSP 2 Score: 36.5798 bits (83), Expect = 5.850e-25
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 2
Query:  803 ISLVGGDEAHCVSEWAHNFPPLY 871
            + LV  DEAHC+S+W H+F P Y
Sbjct:  133 VPLVAIDEAHCISQWGHDFRPSY 155          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_HAEIN (ATP-dependent DNA helicase recQ OS=Haemophilus influenzae GN=recQ PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.677e-24
Identity = 52/116 (44.83%), Postives = 74/116 (63.79%), Query Frame = 1
Query:  433 LLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQLRHLPP-VIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            +L+ V+GY SFR GQ E I   L+ +  ++V+ TG GKSLCYQIPA+   GLTLV+ PL++LM DQ+  L    I   FL+SSQ  E+  +    +  G +K+L+VSPE+ +   F
Sbjct:   19 VLKSVFGYQSFRKGQEEVINAALNGQDALVVMATGNGKSLCYQIPALCFDGLTLVISPLISLMKDQVDQLQANGIEADFLNSSQTLEQQQQVQNKLISGQLKLLYVSPEKVMTNSF 134          

HSP 2 Score: 36.5798 bits (83), Expect = 1.677e-24
Identity = 13/32 (40.62%), Postives = 19/32 (59.38%), Query Frame = 2
Query:  776 FCNIYCYFIISLVGGDEAHCVSEWAHNFPPLY 871
            F  +  Y  +  +  DEAHC+S+W H+F P Y
Sbjct:  134 FFQLISYSKVCFIAIDEAHCISQWGHDFRPEY 165          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_PASMU (ATP-dependent DNA helicase recQ OS=Pasteurella multocida GN=recQ PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.839e-24
Identity = 51/116 (43.97%), Postives = 73/116 (62.93%), Query Frame = 1
Query:  433 LLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQL-RHLPPVIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            +L  V+GY SFR GQ E I   L  K +++++ TG GKSLCYQIPA+   GLTLV+ PL++LM DQ+ + L   I   +L+SSQ   E  +    +  G +K+L+VSPE+ +   F
Sbjct:   29 VLHAVFGYQSFRKGQEEVIDATLMGKDSLVIMATGNGKSLCYQIPALCFEGLTLVISPLISLMKDQVDQLLANGIEADYLNSSQTFTEQQQVQNKLMSGTLKLLYVSPEKVMTTSF 144          

HSP 2 Score: 37.3502 bits (85), Expect = 2.839e-24
Identity = 14/32 (43.75%), Postives = 21/32 (65.62%), Query Frame = 2
Query:  776 FCNIYCYFIISLVGGDEAHCVSEWAHNFPPLY 871
            F ++  +  +S V  DEAHC+S+W H+F P Y
Sbjct:  144 FFHLISHCKVSFVAIDEAHCISQWGHDFRPEY 175          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_ECOLI (ATP-dependent DNA helicase recQ OS=Escherichia coli (strain K12) GN=recQ PE=1 SV=5)

HSP 1 Score: 97.0561 bits (240), Expect = 1.060e-23
Identity = 50/117 (42.74%), Postives = 77/117 (65.81%), Query Frame = 1
Query:  430 RLLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQLRHLPP-VIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            ++L+  +GY  FR GQ E I  VL  +  ++V+PTG GKSLCYQIPA++L GLT+VV PL++LM DQ+  L    +    L+S+Q  E+  E +   + G I++L+++PER +  +F
Sbjct:   15 QVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLMLDNF 131          

HSP 2 Score: 34.6538 bits (78), Expect = 1.060e-23
Identity = 12/21 (57.14%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  809 LVGGDEAHCVSEWAHNFPPLY 871
            L+  DEAHC+S+W H+F P Y
Sbjct:  142 LLAVDEAHCISQWGHDFRPEY 162          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_SALTY (ATP-dependent DNA helicase recQ OS=Salmonella typhimurium GN=recQ PE=3 SV=3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.474e-22
Identity = 48/117 (41.03%), Postives = 76/117 (64.96%), Query Frame = 1
Query:  430 RLLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQL-RHLPPVIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            ++L+  +GY  FR GQ   I   L  +  ++V+PTG GKSLCYQIPA++L GLT+VV PL++LM DQ+ + L   +    L+S+Q  E+  E +   + G I++L+++PER +  +F
Sbjct:   15 QVLQETFGYQQFRPGQEAIIDTALSGRDCLVVMPTGGGKSLCYQIPALLLDGLTVVVSPLISLMKDQVDQLLANGVAAACLNSTQSREQQLEVMAGCRTGQIRLLYIAPERLMLDNF 131          

HSP 2 Score: 34.6538 bits (78), Expect = 1.474e-22
Identity = 12/21 (57.14%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  809 LVGGDEAHCVSEWAHNFPPLY 871
            L+  DEAHC+S+W H+F P Y
Sbjct:  142 LLAVDEAHCISQWGHDFRPEY 162          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ4_HUMAN (ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=RECQL4 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.466e-22
Identity = 47/111 (42.34%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  451 GYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMIL----PGLTLVVCPLVALMIDQLRHLPPVIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNA 771
            G+ +FR GQ  A+  +L   ST+LVLPTGAGKSLCYQ+PA++     P LTLVV PL++LM DQ+  LPP +    + S    ++    ++ I+   + VL ++PE  + A
Sbjct:  477 GHQAFRPGQERAVMRILSGISTLLVLPTGAGKSLCYQLPALLYSRRSPCLTLVVSPLLSLMDDQVSGLPPCLKAACIHSGMTRKQRESVLQKIRAAQVHVLMLTPEALVGA 587          

HSP 2 Score: 36.965 bits (84), Expect = 2.466e-22
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = 2
Query:  821 DEAHCVSEWAHNFPPLYM 874
            DEAHC+S+W+HNF P Y+
Sbjct:  605 DEAHCLSQWSHNFRPCYL 622          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ4_MOUSE (ATP-dependent DNA helicase Q4 OS=Mus musculus GN=Recql4 PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 4.173e-22
Identity = 49/106 (46.23%), Postives = 66/106 (62.26%), Query Frame = 1
Query:  451 GYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMIL----PGLTLVVCPLVALMIDQLRHLPPVIHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPE 756
            GY +FR GQ  AI  +L   ST+LVLPTGAGKSLCYQ+PA++     P LTLVV PL++LM DQ+  LP  +    L S    ++    ++ ++   + VL VSPE
Sbjct:  494 GYRAFRPGQERAIMRILSGISTLLVLPTGAGKSLCYQLPALLYAQRSPCLTLVVSPLLSLMDDQVSDLPSCLKAACLHSGMTKKQRESVLKKVRAAQVHVLIVSPE 599          

HSP 2 Score: 35.4242 bits (80), Expect = 4.173e-22
Identity = 11/18 (61.11%), Postives = 15/18 (83.33%), Query Frame = 2
Query:  821 DEAHCVSEWAHNFPPLYM 874
            DE HC+S+W+HNF P Y+
Sbjct:  627 DEVHCLSQWSHNFRPCYL 644          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ_SYNY3 (ATP-dependent DNA helicase recQ OS=Synechocystis sp. (strain PCC 6803) GN=recQ PE=3 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.676e-19
Identity = 53/127 (41.73%), Postives = 78/127 (61.42%), Query Frame = 1
Query:  409 ASNENLGRLLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQL-----RHLPPVIHGGFLSSSQRPEEVAETIRLIQVG--AIKVLFVSPERFLN 768
            A  ++L   LR ++GYD FR  Q E I  +L ++  ++VLPTG GKS+C+Q+PA++  GLTLVV PLVALM DQ+     ++LP       LS  +R +       L Q+G   +K+L++SPE  L+
Sbjct:    2 ADRQSLEEALRRIWGYDHFRYPQGEVIDCLLARRDCLVVLPTGGGKSICFQLPALLGEGLTLVVSPLVALMEDQVQSLRRQNLPAACLHSQLSRPERKQV------LYQLGQQQLKLLYLSPETLLS 122          

HSP 2 Score: 28.1054 bits (61), Expect = 6.676e-19
Identity = 9/17 (52.94%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  821 DEAHCVSEWAHNFPPLY 871
            DEAHC+ +W  +F P Y
Sbjct:  142 DEAHCLVQWGDSFRPAY 158          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ1_RAT (ATP-dependent DNA helicase Q1 OS=Rattus norvegicus GN=Recql PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 8.634e-19
Identity = 47/112 (41.96%), Postives = 68/112 (60.71%), Query Frame = 1
Query:  433 LLRLVYGYDSFRDGQLEAIKMVLDKKSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQLRHLPPV-IHGGFLSSSQRPEEV--AETIRLIQVGAIKVLFVSPER 759
            +LR V+    FR  QLE +   + +K   LV+PTG GKSLCYQ+PA+   G TLV+CPL++LM DQL  L  + I    L+SS   E V    T  + +   +K+++V+PE+
Sbjct:   82 VLRDVFKLQKFRPLQLETVNATMARKDIFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLMVLQQLGISATMLNSSSSKEHVKCVHTEMMNKNSHLKLIYVTPEK 193          

HSP 2 Score: 30.8018 bits (68), Expect = 8.634e-19
Identity = 11/20 (55.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  812 VGGDEAHCVSEWAHNFPPLY 871
            V  DE HC S+W H+F P Y
Sbjct:  216 VAVDEVHCCSQWGHDFRPDY 235          
BLAST of EY659272 vs. ExPASy Swiss-Prot
Match: RECQ5_HUMAN (ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=RECQL5 PE=1 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 1.112e-18
Identity = 46/121 (38.02%), Postives = 74/121 (61.16%), Query Frame = 1
Query:  436 LRLVYGYDSFRDGQLEAIKMVLDK--KSTMLVLPTGAGKSLCYQIPAMILPGLTLVVCPLVALMIDQLRHLPPV-----IHGGFLSSSQRPEEVAETIRLIQVGAIKVLFVSPERFLNADF 777
            L+ V+G+DSF+    E+  M + K  K   + +PTGAGKSLCYQ+PA++  G+T+VV PL+AL+ DQ+ HL  +          LS+ +R E +A+  R  +    K+L+++PE   ++ F
Sbjct:   20 LKKVFGFDSFKTPLQESATMAVVKGNKDVFVCMPTGAGKSLCYQLPALLAKGITIVVSPLIALIQDQVDHLLTLKVRVSSLNSKLSAQERKELLADLER--EKPQTKILYITPEMAASSSF 138          

HSP 2 Score: 35.4242 bits (80), Expect = 1.112e-18
Identity = 13/25 (52.00%), Postives = 19/25 (76.00%), Query Frame = 2
Query:  800 IISLVGGDEAHCVSEWAHNFPPLYM 874
            ++S +  DEAHCVS+W H+F P Y+
Sbjct:  150 LLSYLVVDEAHCVSQWGHDFRPDYL 174          
The following BLAST results are available for this feature:
BLAST of EY659272 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
RECQ_BACSU5.850e-2540.17Probable ATP-dependent DNA helicase recQ OS=Bacill... [more]
RECQ_HAEIN1.677e-2444.83ATP-dependent DNA helicase recQ OS=Haemophilus inf... [more]
RECQ_PASMU2.839e-2443.97ATP-dependent DNA helicase recQ OS=Pasteurella mul... [more]
RECQ_ECOLI1.060e-2342.74ATP-dependent DNA helicase recQ OS=Escherichia col... [more]
RECQ_SALTY1.474e-2241.03ATP-dependent DNA helicase recQ OS=Salmonella typh... [more]
RECQ4_HUMAN2.466e-2242.34ATP-dependent DNA helicase Q4 OS=Homo sapiens GN=R... [more]
RECQ4_MOUSE4.173e-2246.23ATP-dependent DNA helicase Q4 OS=Mus musculus GN=R... [more]
RECQ_SYNY36.676e-1941.73ATP-dependent DNA helicase recQ OS=Synechocystis s... [more]
RECQ1_RAT8.634e-1941.96ATP-dependent DNA helicase Q1 OS=Rattus norvegicus... [more]
RECQ5_HUMAN1.112e-1838.02ATP-dependent DNA helicase Q5 OS=Homo sapiens GN=R... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659272 ID=EY659272|Name=EY659272|organism=Citrus sinensis|type=EST|length=924bp
CAGGTTTCCGGTCCGNATTCCCGCCTCGACCCAGCGTCCGCCAAGTATTA
ACGGAATCAAAATGATGCATCCGCTAAGAAGAAGAAGCAAATTAATTTAG
TAAGCGTTGATGTTCCCTTGCCGCCGGCAAAATTGCGAAAATGTAACGGT
GAAGGTAACTTCGTGAGGTTGAATCTGAATAACAATAAGCGTAAATTCGC
TAACAAAGGTAAAAGAAATAAGTCATTTAGAGGTAAACTCTCTTATAGGA
GAAGCAAGAAGAAGTTGAATAAAAATGAAACAGAGAGTAAAGGAGCTGAA
GATGAATACGGTTTGATTATTGAAAATCTTGAGCAGAATCAGAAGAATAG
AAGAGCTGCTGGTGAGCTTGAGTTGGTGGAAGACGCGGTGAGAGCCGTCA
AAGACGAGGCTTCGAATGAGAATCTAGGGAGGTTGTTGAGGCTTGTGTAT
GGTTATGATTCGTTTCGCGATGGACAGCTAGAGGCCATAAAGATGGTCCT
TGATAAGAAGTCAACGATGCTGGTTTTGCCAACTGGTGCAGGGAAATCGT
TGTGTTATCAGATACCGGCAATGATTTTGCCAGGGCTGACTCTGGTTGTT
TGTCCCTTAGTGGCTTTAATGATTGATCAATTGAGGCATCTGCCTCCAGT
GATTCATGGCGGCTTTTTGAGTAGTAGTCAGAGACCTGAAGAGGTTGCTG
AGACGATAAGGCTGATTCAAGTAGGGGCAATAAAGGTGCTTTTTGTTTCT
CCAGAAAGATTTTTAAATGCAGATTTTTTGTAATATTTACTGCTACTTCA
TTATATCACTTGTTGGGGGGGATGAAGCTCACTGTGTATCTGAGTGGGCA
CATAATTTTCCGCCCTTATACATGAGGCTTAGAGCGTCCCTACTTCGAGC
AAGGCTCAAATGTGAGTGCATTCT
back to top