EY659269

Overview
NameEY659269
Unique NameEY659269
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length934
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMGI_MESCR (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Mesembryanthemum crystallinum GN=PGM1 PE=2 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 9.557e-110
Identity = 166/190 (87.37%), Postives = 176/190 (92.63%), Query Frame = 1
Query:   13 ADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEA 582
            A+TPTMDS  + AP +WRL+RAHG AVGLPTEDDMGNSEVGHNALGAGRI+AQGAKLVDLAL SGKIY  EGFNYIK SFET TLHLIGLLSDGGVHSRLDQLQLLLKG++ERGAKRIR+HILTDGRDVLDGSSVGFVET+E DLA+LR KGVDAQIASGGGRMYVTMDRYENDW VVKR WDAQVLGEA
Sbjct:   44 AETPTMDSLKQGAPEKWRLIRAHGKAVGLPTEDDMGNSEVGHNALGAGRIYAQGAKLVDLALESGKIYDGEGFNYIKESFETNTLHLIGLLSDGGVHSRLDQLQLLLKGSAERGAKRIRVHILTDGRDVLDGSSVGFVETLENDLAQLRAKGVDAQIASGGGRMYVTMDRYENDWSVVKRGWDAQVLGEA 233          

HSP 2 Score: 81.6481 bits (200), Expect = 9.557e-110
Identity = 38/51 (74.51%), Postives = 44/51 (86.27%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            +KF +AVEAVK LR++P ANDQYLP FV+VDE+GKAVGPIV GDA VT NF
Sbjct:  235 YKFKNAVEAVKTLRQEPKANDQYLPPFVVVDESGKAVGPIVDGDAVVTLNF 285          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMGI_RICCO (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ricinus communis PE=1 SV=2)

HSP 1 Score: 333.183 bits (853), Expect = 9.557e-110
Identity = 160/190 (84.21%), Postives = 177/190 (93.16%), Query Frame = 1
Query:   13 ADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEA 582
            A+TPTMDSF K+AP RWRL++AHG+AVGLPTEDDMGNSEVGHNALGAGRI+AQGAKLVDLALASGKIY+ EGF Y+K  F+ GTLHLIGLLSDGGVHSRLDQLQLLLKGA+E GAKRIR+H+LTDGRDV+DG+SVGF ET+EKDL  LR KGVDAQ+ASGGGRMYVTMDRYENDW+VVKR WDAQVLGEA
Sbjct:   41 AETPTMDSFKKTAPERWRLIKAHGTAVGLPTEDDMGNSEVGHNALGAGRIYAQGAKLVDLALASGKIYEGEGFKYVKECFDKGTLHLIGLLSDGGVHSRLDQLQLLLKGAAEHGAKRIRVHVLTDGRDVIDGTSVGFAETLEKDLENLREKGVDAQVASGGGRMYVTMDRYENDWNVVKRGWDAQVLGEA 230          

HSP 2 Score: 86.2705 bits (212), Expect = 9.557e-110
Identity = 41/51 (80.39%), Postives = 44/51 (86.27%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            +KF SAVEA+KKLRE+P ANDQYLP FVIVDENGK VGPIV GDA VT NF
Sbjct:  232 YKFKSAVEAIKKLREEPKANDQYLPPFVIVDENGKPVGPIVDGDAVVTINF 282          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMG1_ARATH (2,3-bisphosphoglycerate-independent phosphoglycerate mutase 1 OS=Arabidopsis thaliana GN=PGM1 PE=2 SV=3)

HSP 1 Score: 314.694 bits (805), Expect = 3.352e-104
Identity = 153/190 (80.53%), Postives = 168/190 (88.42%), Query Frame = 1
Query:   13 ADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEA 582
            A TP MDS    AP  W L++AHG+AVGLP+EDDMGNSEVGHNALGAGRIFAQGAKL D ALASGKI++ EGF Y+  SFET TLHL+GLLSDGGVHSRLDQLQLL+KG++ERGAKRIR+HILTDGRDVLDGSSVGFVET+E DL  LR  GVDAQIASGGGRMYVT+DRYENDW+VVKR WDAQVLGEA
Sbjct:   43 APTPAMDSLKHGAPDTWTLIKAHGTAVGLPSEDDMGNSEVGHNALGAGRIFAQGAKLCDQALASGKIFEGEGFKYVSESFETNTLHLVGLLSDGGVHSRLDQLQLLIKGSAERGAKRIRVHILTDGRDVLDGSSVGFVETLEADLVALRENGVDAQIASGGGRMYVTLDRYENDWEVVKRGWDAQVLGEA 232          

HSP 2 Score: 86.2705 bits (212), Expect = 3.352e-104
Identity = 41/51 (80.39%), Postives = 45/51 (88.24%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            HKF +AVEAVK LR++P ANDQYLP FVIVDE+GKAVGPIV GDA VTFNF
Sbjct:  234 HKFKNAVEAVKTLRKEPGANDQYLPPFVIVDESGKAVGPIVDGDAVVTFNF 284          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMGI_PRUDU (2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Fragment) OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 8.307e-94
Identity = 141/162 (87.04%), Postives = 148/162 (91.36%), Query Frame = 1
Query:   97 LPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEA 582
            LPTEDDMGNSEVGHNALGAGRIFAQGAKLVD AL +GK+Y+ EGF YIK SF T TLHLIGLLSDGGVHSRLDQL LL+KGASERGAKRIR+HILTDGRDVLDGSSVGF ET+E  LA+LR KGVDAQIASGGGRMYVTMDRYENDW VVKR WDAQVLGEA
Sbjct:    1 LPTEDDMGNSEVGHNALGAGRIFAQGAKLVDSALETGKLYEGEGFKYIKESFPTNTLHLIGLLSDGGVHSRLDQLLLLVKGASERGAKRIRVHILTDGRDVLDGSSVGFAETLENYLAQLREKGVDAQIASGGGRMYVTMDRYENDWGVVKRGWDAQVLGEA 162          

HSP 2 Score: 85.1149 bits (209), Expect = 8.307e-94
Identity = 39/51 (76.47%), Postives = 44/51 (86.27%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            HKF +AVEA+K LR++PN +DQYLP FVIVDENGK VGPIV GDA VTFNF
Sbjct:  164 HKFKNAVEAIKTLRQEPNTSDQYLPPFVIVDENGKPVGPIVDGDAVVTFNF 214          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMGI_MAIZE (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Zea mays PE=1 SV=1)

HSP 1 Score: 332.798 bits (852), Expect = 1.713e-90
Identity = 164/202 (81.19%), Postives = 178/202 (88.12%), Query Frame = 1
Query:   13 ADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEAHTSLTAPLKLSK 618
            A TP MDS    AP +WRL++AHG+AVGLP++DDMGNSEVGHNALGAGRIFAQGAKLVD ALASGKIY  +GFNYIK SFE+GTLHLIGLLSDGGVHSRLDQLQLLLKG SERGAK+IR+HILTDGRDVLDGSS+GFVET+E DL ELR KGVDAQIASGGGRMYVTMDRYENDWDVVKR WDAQVLGEA     + L+  K
Sbjct:   44 AQTPVMDSLKNGAPEKWRLVKAHGTAVGLPSDDDMGNSEVGHNALGAGRIFAQGAKLVDQALASGKIYDGDGFNYIKESFESGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKKIRVHILTDGRDVLDGSSIGFVETLENDLLELRAKGVDAQIASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPYKFKSALEAVK 245          

HSP 2 Score: 77.411 bits (189), Expect = 1.291e-13
Identity = 36/51 (70.59%), Postives = 42/51 (82.35%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            +KF SA+EAVK LR QP ANDQYLP FVIVD++G AVGP++ GDA VT NF
Sbjct:  235 YKFKSALEAVKTLRAQPKANDQYLPPFVIVDDSGNAVGPVLDGDAVVTINF 285          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMG2_ARATH (Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 OS=Arabidopsis thaliana GN=At3g08590 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.604e-88
Identity = 161/203 (79.31%), Postives = 176/203 (86.70%), Query Frame = 1
Query:   10 RADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEAHTSLTAPLKLSK 618
            +A TP MDS     P  WRL++AHG+AVGLP+EDDMGNSEVGHNALGAGRI+AQGAKLVDLALASGKIY+DEGF YI  SFE GT+HLIGLLSDGGVHSRLDQ+QLLLKG +ERGAKRIR+HILTDGRDVLDGSSVGFVET+E DLA LR KGVDAQ+ASGGGRMYVTMDRYENDW VVKR WDAQVLGEA     + L+  K
Sbjct:   44 KAPTPAMDSLKDGKPDTWRLIKAHGTAVGLPSEDDMGNSEVGHNALGAGRIYAQGAKLVDLALASGKIYEDEGFKYISQSFEKGTVHLIGLLSDGGVHSRLDQVQLLLKGFAERGAKRIRVHILTDGRDVLDGSSVGFVETLEADLAALRAKGVDAQVASGGGRMYVTMDRYENDWSVVKRGWDAQVLGEAPHKFKSALEAVK 246          

HSP 2 Score: 86.2705 bits (212), Expect = 2.779e-16
Identity = 41/51 (80.39%), Postives = 44/51 (86.27%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            HKF SA+EAVK LR +P ANDQYLP FVIVD+NGKAVGPIV GDA VTFNF
Sbjct:  236 HKFKSALEAVKTLRAEPGANDQYLPSFVIVDDNGKAVGPIVDGDAVVTFNF 286          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: PMGI_TOBAC (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 6.094e-88
Identity = 159/208 (76.44%), Postives = 177/208 (85.10%), Query Frame = 1
Query:   13 ADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGEAHTSLTAPLKLSKN*GNSP 636
            A+TP M S    AP +WRL++AHG+AVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIY+ EGF Y+K  FE GTLHLIGLLSDGGVHSRLDQ+QLLLKGA++ GAKRIR+H LTDGRDVLDGSSVGF+ET+E  LA+LR KG+DAQ+ASGGGRMYVTMDRYENDWDVVKR WDAQVLGEA      P++  K     P
Sbjct:   44 AETPVMYSLKNGAPEKWRLIKAHGNAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYEGEGFKYVKECFEKGTLHLIGLLSDGGVHSRLDQVQLLLKGAAKHGAKRIRVHALTDGRDVLDGSSVGFMETLENSLAQLREKGIDAQVASGGGRMYVTMDRYENDWDVVKRGWDAQVLGEAPHKFKDPVEAVKKLRQEP 251          

HSP 2 Score: 78.1814 bits (191), Expect = 7.567e-14
Identity = 37/51 (72.55%), Postives = 41/51 (80.39%), Query Frame = 3
Query:  585 HKFNSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            HKF   VEAVKKLR++PNANDQYL  FVIVD+NGK V  I+ GDA VTFNF
Sbjct:  235 HKFKDPVEAVKKLRQEPNANDQYLAPFVIVDDNGKPVAAILDGDAVVTFNF 285          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: GPMI_LEPIN (Probable 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans GN=gpmI PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 5.029e-51
Identity = 89/172 (51.74%), Postives = 115/172 (66.86%), Query Frame = 1
Query:   70 LRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYI--KPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGE 579
            ++AHG AVG+P++DDMGNSEVGHN LG+GRIF QGAKLV  ++ASG I+  + +  +         TLHL+GL SDG VHS +D  + L+  A      +IRLHIL DGRDV + S++ ++   E  L  LR  G D +IASGGGRM +TMDRYE DW +V+R W   V GE
Sbjct:   59 IQAHGKAVGMPSDDDMGNSEVGHNVLGSGRIFDQGAKLVSNSIASGDIFNGQAWKEVIGNSKKNNSTLHLLGLFSDGNVHSHIDHTKALISQAILEKVPKIRLHILLDGRDVPEKSALDYLNPFETWLDSLRKSGTDIRIASGGGRMTITMDRYEADWSMVERGWKVHVKGE 230          

HSP 2 Score: 46.595 bits (109), Expect = 5.029e-51
Identity = 28/50 (56.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query:  591 FNSAVEAVKKLR-EQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            F+SA EA++  R E P   DQYLP FVI D NGK VG I  GD+ V  NF
Sbjct:  234 FSSAKEAIETFRSENPKIIDQYLPSFVISD-NGKPVGKIQDGDSVVFTNF 282          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: GPMI_LEPIC (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni GN=gpmI PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 5.029e-51
Identity = 89/172 (51.74%), Postives = 115/172 (66.86%), Query Frame = 1
Query:   70 LRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFNYI--KPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGE 579
            ++AHG AVG+P++DDMGNSEVGHN LG+GRIF QGAKLV  ++ASG I+  + +  +         TLHL+GL SDG VHS +D  + L+  A      +IRLHIL DGRDV + S++ ++   E  L  LR  G D +IASGGGRM +TMDRYE DW +V+R W   V GE
Sbjct:   59 IQAHGKAVGMPSDDDMGNSEVGHNVLGSGRIFDQGAKLVSNSIASGDIFNGQAWKEVIGNSKKNNSTLHLLGLFSDGNVHSHIDHTKALISQAILEKVPKIRLHILLDGRDVPEKSALDYLNPFETWLNSLRKSGTDIRIASGGGRMTITMDRYEADWSMVERGWKVHVKGE 230          

HSP 2 Score: 46.595 bits (109), Expect = 5.029e-51
Identity = 28/50 (56.00%), Postives = 32/50 (64.00%), Query Frame = 3
Query:  591 FNSAVEAVKKLR-EQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            F+SA EA++  R E P   DQYLP FVI D NGK VG I  GD+ V  NF
Sbjct:  234 FSSAKEAIETFRSENPKIIDQYLPSFVISD-NGKPVGKIQDGDSVVFTNF 282          
BLAST of EY659269 vs. ExPASy Swiss-Prot
Match: GPMI_HALOH (2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gpmI PE=3 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 2.154e-28
Identity = 81/194 (41.75%), Postives = 116/194 (59.79%), Query Frame = 1
Query:   10 RADTPTMDSFNKSAPGRWRLLRAHGSAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDLALASGKIYQDEGFN----YIKPSFETGTLHLIGLLSDGGVHSRLDQLQLLLKGASERGAKRIRLHILTDGRDVLDGSSVGFVETIEKDLAELRGKGVDAQIASGGGRMYVTMDRYENDWDVVKR*WDAQVLGE 579
            +A TP +D F +  P    +L A G AVGLP E  MGNSEVGH  LGAGRI  Q    ++ A+  G + +++       ++K +     LHL+GLLSDGGVHS ++ L  LL+ A  +  +++ +H + DGRD    S+  ++  +E+ LAEL   G+  +IA+  GR Y TMDR +N WD  K+ +DA VLGE
Sbjct:   28 QAHTPNLDKFFEEYPDT--VLDASGEAVGLP-EGQMGNSEVGHLNLGAGRIVYQDYTRINKAIEEGTLPENDALKNAIQHVKDN--NSALHLMGLLSDGGVHSHINHLFGLLEMARVKNIEKVYVHPILDGRDTPPRSAEKYLNQLEEKLAEL---GI-GEIATVSGR-YYTMDR-DNRWDRTKKSYDALVLGE 210          

HSP 2 Score: 27.7202 bits (60), Expect = 2.154e-28
Identity = 13/48 (27.08%), Postives = 27/48 (56.25%), Query Frame = 3
Query:  594 NSAVEAVKKLREQPNANDQYLPXFVIVDENGKAVGPIVXGDASVTFNF 737
            + A+ A+K+      +++  +P   ++ +NG+ VG I   DA + +NF
Sbjct:  215 SDAISALKQSYAADKSDEFVIP--TVIKKNGQPVGTIKDNDAVIFYNF 260          
The following BLAST results are available for this feature:
BLAST of EY659269 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 272
Match NameE-valueIdentityDescription
PMGI_MESCR9.557e-11087.372,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_RICCO9.557e-11084.212,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMG1_ARATH3.352e-10480.532,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_PRUDU8.307e-9487.042,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMGI_MAIZE1.713e-9081.192,3-bisphosphoglycerate-independent phosphoglycera... [more]
PMG2_ARATH1.604e-8879.31Probable 2,3-bisphosphoglycerate-independent phosp... [more]
PMGI_TOBAC6.094e-8876.442,3-bisphosphoglycerate-independent phosphoglycera... [more]
GPMI_LEPIN5.029e-5151.74Probable 2,3-bisphosphoglycerate-independent phosp... [more]
GPMI_LEPIC5.029e-5151.742,3-bisphosphoglycerate-independent phosphoglycera... [more]
GPMI_HALOH2.154e-2841.752,3-bisphosphoglycerate-independent phosphoglycera... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659269 ID=EY659269|Name=EY659269|organism=Citrus sinensis|type=EST|length=934bp
CCACGCGTCCGCGCCGACACTCCCACCATGGACTCTTTCAATAAGTCTGC
CCCTGGGAGGTGGAGGTTGCTCCGAGCTCACGGTAGTGCTGTGGGGCTTC
CAACTGAAGATGACATGGGTAACAGTGAAGTCGGTCATAATGCACTCGGT
GCTGGTCGCATTTTTGCTCAAGGTGCAAAGCTTGTTGACCTTGCTCTGGC
CTCTGGGAAAATCTATCAAGATGAGGGATTTAATTACATTAAGCCATCTT
TTGAAACCGGCACATTGCACCTTATTGGGTTACTGAGTGATGGTGGAGTA
CACTCTAGGCTTGATCAACTTCAGTTGTTGCTAAAAGGAGCTAGTGAGCG
TGGTGCTAAAAGAATTCGTCTTCATATTCTTACTGACGGGCGTGATGTTT
TGGATGGTTCAAGCGTAGGATTCGTAGAAACTATTGAGAAAGATCTTGCA
GAATTGCGTGGGAAAGGTGTTGACGCGCAGATTGCATCTGGAGGAGGCCG
CATGTACGTCACGATGGACCGTTATGAGAATGATTGGGATGTTGTCAAAC
GATGATGGGATGCCCAAGTTCTTGGAGAAGCTCACACAAGTTTAACAGCG
CCGTTGAAGCTGTCAAAAAACTAAGGGAACAGCCCAATGCCAATGACCAG
TACTTACCTNCATTTGTCATTGTTGATGAAAATGGAAAAGCTGTGGGTCC
AATAGTANATGGTGATGCNAGTGTAACTTTCAACTTCGAGCTGATCGAAT
GGTATGCTTGCTAAGCCCCTGATATGAAGATTTGACAATTGGATCCGAGT
CGGGTCCCTAAATNCGTATGCTGGATGCTCATATGATGGGGGAGTGAAAC
TCCAGTCATACCNTGNNGTCTCTCGAGATGACAGACTCTGGGAATATTAT
GCATAATGGGGTCCGACTTTGCTGCANGAGATGT
back to top