EY659268

Overview
NameEY659268
Unique NameEY659268
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8110 contig Csv1_Contig8110:113..1014. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: MTDH_FRAAN (Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.506e-103
Identity = 141/205 (68.78%), Postives = 162/205 (79.02%), Query Frame = 3
Query:   27 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            A EQEH K A GWAARD+SGVLSPF+F RR TGEKDVTFKV +CGICHSDLH++KNEWG + YP+VPGHEIVG VTEVGSKV KFKVGD+VGVGC+VGSCRSC++C   LENYCPK I+TY +KY+DG+ TYGGYSD MVADEHF+VRIP+  PLD  APLLCAGIT YSPLR++GL +P                 KFAK  G+
Sbjct:    2 AIEQEHRKKASGWAARDSSGVLSPFNFYRRETGEKDVTFKVLYCGICHSDLHMVKNEWGFSTYPLVPGHEIVGEVTEVGSKVQKFKVGDRVGVGCIVGSCRSCENCTDHLENYCPKQILTYGAKYYDGSTTYGGYSDIMVADEHFIVRIPDNLPLDGAAPLLCAGITTYSPLRYFGLDKPGMHVGVVGLGGLGHVAVKFAKAMGV 206          

HSP 2 Score: 86.2705 bits (212), Expect = 4.506e-103
Identity = 46/69 (66.67%), Postives = 52/69 (75.36%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQL-PLLRGGK 900
            GADSFLVSRDQD+MQAA+G MDGIIDTVSA HPL+P+IG + S GK    GAPEK     + PLL G K
Sbjct:  226 GADSFLVSRDQDQMQAAIGTMDGIIDTVSAQHPLLPLIGLLNSHGKLVMVGAPEKPLELPVFPLLMGRK 294          

HSP 3 Score: 28.1054 bits (61), Expect = 4.506e-103
Identity = 14/20 (70.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEA 685
            KAMGV VTVIST P +  EA
Sbjct:  202 KAMGVKVTVISTSPKKEEEA 221          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: MTDH_MESCR (Probable mannitol dehydrogenase OS=Mesembryanthemum crystallinum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 6.375e-102
Identity = 142/204 (69.61%), Postives = 160/204 (78.43%), Query Frame = 3
Query:   27 APEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            APE  HP+ AFGWAARDTSG LSP  FSRRATGE+DVTFKV +CGICHSDLH IKNEWGNA+YP +PGHEIVGVVTEVG+KV  FKVGDKVGVGCMVGSCRSC+SC   LENYCPK+I+TY S Y+DGT+TYGGYSD MV +EHF VRIP+   LDATAPLLCAG+TVYSPL+ + L +P                 KF K +G
Sbjct:    5 APENVHPQKAFGWAARDTSGTLSPLKFSRRATGEQDVTFKVLYCGICHSDLHYIKNEWGNAVYPAIPGHEIVGVVTEVGNKVQNFKVGDKVGVGCMVGSCRSCESCENHLENYCPKMILTYGSTYYDGTLTYGGYSDIMVVEEHFAVRIPDNMALDATAPLLCAGVTVYSPLKHFELDKPGLHIGVVGLGGLGHMAVKFGKAFG 208          

HSP 2 Score: 82.4185 bits (202), Expect = 6.375e-102
Identity = 41/71 (57.75%), Postives = 54/71 (76.06%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQL-PLLRGGK 900
            R GADSF+VSR+ ++MQ+AMG +DGIIDTVSA HPL+P++G +KSQGK    G P+K     + PLL+G K
Sbjct:  227 RLGADSFVVSREPEQMQSAMGTLDGIIDTVSAAHPLLPLLGLLKSQGKMIMVGVPDKPLELPVFPLLQGRK 297          

HSP 3 Score: 24.6386 bits (52), Expect = 6.375e-102
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEA 685
            KA G  VTVIST P +  EA
Sbjct:  205 KAFGAKVTVISTSPNKKDEA 224          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: GEDH1_OCIBA (Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GEDH1 PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.553e-90
Identity = 133/207 (64.25%), Postives = 155/207 (74.88%), Query Frame = 3
Query:   18 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            M ++PE EHP  A GWAA D SG  SPF+FSRRATGE+DV F+V +CG+CHSDLH++KNEWG   YPIVPGHEIVG+VTEVGSKV K K+GDKVGVG +VGSCR CD C+ DLENYC K I+TY + Y DGTI  GGYSD MVADEHF++R PE  PLDA APLLCAGIT YSPL+++GL +P                 KFAK +G
Sbjct:    1 MAKSPETEHPVKALGWAATDNSGTFSPFNFSRRATGERDVQFRVLYCGVCHSDLHMVKNEWGVTHYPIVPGHEIVGIVTEVGSKVEKVKIGDKVGVGVLVGSCRQCDQCSNDLENYCYKQILTYGAPYLDGTIARGGYSDIMVADEHFIIRWPENFPLDAGAPLLCAGITTYSPLKYFGLDKPGLRVGVNGLGGLGHVAVKFAKAFG 207          

HSP 2 Score: 66.2402 bits (160), Expect = 1.553e-90
Identity = 32/63 (50.79%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPL 885
            G D F+VS D  +MQAA+G +DGIIDTVSA HP++P++  +K  GK    G P+K    QLP+
Sbjct:  228 GVDEFVVSTDPQQMQAAVGTLDGIIDTVSAPHPIVPLLSLLKPHGKLIVVGLPDK--PLQLPV 288          

HSP 3 Score: 21.9422 bits (45), Expect = 1.553e-90
Identity = 13/29 (44.83%), Postives = 15/29 (51.72%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEARDVLALIPF 712
            KA G  VTVIST   +  EA   L +  F
Sbjct:  204 KAFGTKVTVISTSLSKKEEAMQHLGVDEF 232          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH8_ARATH (Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 9.909e-90
Identity = 129/197 (65.48%), Postives = 149/197 (75.63%), Query Frame = 3
Query:   48 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            K AFG AA+D SGVLSPF F+RR TGEKDV FKV  CGICHSDLH++KNEWG + YP+VPGHEIVGVVTEVG+KV+KFK G+KVGVGC+V SC SCDSC   +ENYCPK I TY   Y+D TITYGGYSD MV +E FV+RIP+  PLDA APLLCAGITVYSP++++GL +P                 KFAK  G
Sbjct:    7 KEAFGLAAKDNSGVLSPFSFTRRETGEKDVRFKVLFCGICHSDLHMVKNEWGMSTYPLVPGHEIVGVVTEVGAKVTKFKTGEKVGVGCLVSSCGSCDSCTEGMENYCPKSIQTYGFPYYDNTITYGGYSDHMVCEEGFVIRIPDNLPLDAAAPLLCAGITVYSPMKYHGLDKPGMHIGVVGLGGLGHVGVKFAKAMG 203          

HSP 2 Score: 73.9442 bits (180), Expect = 9.909e-90
Identity = 37/66 (56.06%), Postives = 49/66 (74.24%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLPLL 888
            R GAD+FLVSRD  +++ AMG MDGIIDTVSA H L+P++G +K +GK    GAPEK    +LP++
Sbjct:  222 RLGADAFLVSRDPKQIKDAMGTMDGIIDTVSATHSLLPLLGLLKHKGKLVMVGAPEK--PLELPVM 285          

HSP 3 Score: 23.483 bits (49), Expect = 9.909e-90
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEA 685
            KAMG  VTVIST   +  EA
Sbjct:  200 KAMGTKVTVISTSEKKRDEA 219          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: MTDH_APIGR (Mannitol dehydrogenase OS=Apium graveolens GN=MTD PE=1 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.088e-87
Identity = 131/207 (63.29%), Postives = 153/207 (73.91%), Query Frame = 3
Query:   18 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            M ++ E EHP  AFGWAARDT+G+LSPF FSRRATGEKDV  KV  CG+CHSD H+I N WG   YPIVPGHEIVGVVTEVGSKV K KVGD VG+GC+VGSCRSC+SC  + E++C   I TY S Y DGT+T+GGYSDTMVADEHF++R P+  PLD+ APLLCAGIT YSPL++YGL +P                 K AK +G
Sbjct:    1 MAKSSEIEHPVKAFGWAARDTTGLLSPFKFSRRATGEKDVRLKVLFCGVCHSDHHMIHNNWGFTTYPIVPGHEIVGVVTEVGSKVEKVKVGDNVGIGCLVGSCRSCESCCDNRESHCENTIDTYGSIYFDGTMTHGGYSDTMVADEHFILRWPKNLPLDSGAPLLCAGITTYSPLKYYGLDKPGTKIGVVGLGGLGHVAVKMAKAFG 207          

HSP 2 Score: 65.4698 bits (158), Expect = 2.088e-87
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQLP---LLRGGK 900
            + GADSFL++ DQ++M+ A   +DGIIDTV   HPL P+   +K  GK    GAPEK   ++LP   LL+G K
Sbjct:  226 KLGADSFLLNSDQEQMKGARSSLDGIIDTVPVNHPLAPLFDLLKPNGKLVMVGAPEK--PFELPVFSLLKGRK 296          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: MTDH_MEDSA (Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 8.016e-86
Identity = 120/208 (57.69%), Postives = 149/208 (71.63%), Query Frame = 3
Query:   18 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            M ++PE E P  AFGWAARDTSG LSPFHFSRR  G+ DV+ K+ +CG+CHSDLH +KN+WG   YP+VPGHEIVGVVT+VG  V KF+VGD VGVG +V SC++C++C  DLE YCPK + TY S Y  GT TYGGYSD +V  + +VV+ P+  PLDA APLLCAGITVYSP+++YG+ +P                 KF K +GL
Sbjct:    1 MAKSPETELPLKAFGWAARDTSGTLSPFHFSRRENGDDDVSVKILYCGVCHSDLHTLKNDWGFTTYPVVPGHEIVGVVTKVGINVKKFRVGDNVGVGVIVESCQTCENCNQDLEQYCPKPVFTYNSPY-KGTRTYGGYSDFVVVHQRYVVQFPDNLPLDAGAPLLCAGITVYSPMKYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGL 207          

HSP 2 Score: 72.7886 bits (177), Expect = 8.016e-86
Identity = 38/71 (53.52%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQL-PLLRGGK 900
            + GADSFLVS+D ++M+AAMG MD IIDT+SA H LMP++G +K  GK  T G P K     + PL+ G K
Sbjct:  225 KLGADSFLVSKDPEKMKAAMGTMDYIIDTISAAHSLMPLLGLLKLNGKLVTVGLPSKPLELSVFPLVAGRK 295          

HSP 3 Score: 27.7202 bits (60), Expect = 8.016e-86
Identity = 15/29 (51.72%), Postives = 18/29 (62.07%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEARDVLALIPF 712
            KA G+ VTVIST P + +EA D L    F
Sbjct:  203 KAFGLKVTVISTSPNKETEAIDKLGADSF 231          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH7_ARATH (Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2)

HSP 1 Score: 258.84 bits (660), Expect = 8.674e-85
Identity = 123/197 (62.44%), Postives = 143/197 (72.59%), Query Frame = 3
Query:   48 KNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            K AFG AA+D SG+LSPF FSRRATGEKDV FKV  CGICH+DL + KNEWG   YP+VPGHEIVGVVTEVG+KV KF  GDKVGVG M GSCRSCDSC    ENYCPK+I+T  +K  D T+T+GGYSD MV  E F++RIP+  PLD  APLLCAG+TVYSP++++GL +P                 KFAK  G
Sbjct:    7 KEAFGLAAKDESGILSPFSFSRRATGEKDVRFKVLFCGICHTDLSMAKNEWGLTTYPLVPGHEIVGVVTEVGAKVKKFNAGDKVGVGYMAGSCRSCDSCNDGDENYCPKMILTSGAKNFDDTMTHGGYSDHMVCAEDFIIRIPDNLPLDGAAPLLCAGVTVYSPMKYHGLDKPGMHIGVVGLGGLGHVAVKFAKAMG 203          

HSP 2 Score: 75.0998 bits (183), Expect = 8.674e-85
Identity = 35/55 (63.64%), Postives = 44/55 (80.00%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAP 855
            R GAD+FLVSRD  +M+ AMG MDGIIDTVSA HPL+P++G +K++GK    GAP
Sbjct:  222 RLGADAFLVSRDPKQMKDAMGTMDGIIDTVSATHPLLPLLGLLKNKGKLVMVGAP 276          

HSP 3 Score: 23.483 bits (49), Expect = 8.674e-85
Identity = 12/20 (60.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  626 KAMGVNVTVISTXP*QXSEA 685
            KAMG  VTVIST   +  EA
Sbjct:  200 KAMGTKVTVISTSERKRDEA 219          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH6_ARATH (Probable cinnamyl alcohol dehydrogenase 6 OS=Arabidopsis thaliana GN=CAD6 PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 2.985e-83
Identity = 118/202 (58.42%), Postives = 148/202 (73.27%), Query Frame = 3
Query:   33 EQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            E+E    AFGWAARD+SG LSPF FSRR TGE++V  KV +CGICHSDLH +KNEW ++IYP+VPGHEI+G V+E+G+KVSKF +GDKVGVGC+V SCR+C+SC  D ENYC K I TY   +HDGTI YGGYSD +V DE + V+IP   PL + APLLCAGI++YSP++++GL  P                 +FAK +G
Sbjct:    7 EKEQSVEAFGWAARDSSGHLSPFVFSRRKTGEEEVRVKVLYCGICHSDLHCLKNEWHSSIYPLVPGHEIIGEVSEIGNKVSKFNLGDKVGVGCIVDSCRTCESCREDQENYCTKAIATYNGVHHDGTINYGGYSDHIVVDERYAVKIPHTLPLVSAAPLLCAGISMYSPMKYFGLTGPDKHVGIVGLGGLGHIGVRFAKAFG 208          

HSP 2 Score: 73.559 bits (179), Expect = 2.985e-83
Identity = 36/55 (65.45%), Postives = 42/55 (76.36%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEK 861
            GAD FLVS D+D+M+AAMG MDGIIDTVSA H + P+IG +KS GK    GA EK
Sbjct:  229 GADGFLVSTDEDQMKAAMGTMDGIIDTVSASHSISPLIGLLKSNGKLVLLGATEK 283          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: CADH9_ARATH (Probable cinnamyl alcohol dehydrogenase 9 OS=Arabidopsis thaliana GN=CAD9 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 4.255e-82
Identity = 117/208 (56.25%), Postives = 146/208 (70.19%), Query Frame = 3
Query:   18 MGQAPEQEHPKNAFGWAARDTSGVLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWGL 641
            M ++PE EHP   FGW ARD SGVLSPFHFSRR  GE DVT K+  CG+CH+DLH IKN+WG + YP+VPGHEIVG+ T+VG  V+KFK GD+VGVG + GSC+SC+SC  DLENYCP++  TY +   DGT  YGGYS+ +V D+ FV+R PE  P D+ APLLCAGITVYSP+++YG+ +                  K  K +GL
Sbjct:    1 MAKSPETEHPNKVFGWGARDKSGVLSPFHFSRRDNGENDVTVKILFCGVCHTDLHTIKNDWGYSYYPVVPGHEIVGIATKVGKNVTKFKEGDRVGVGVISGSCQSCESCDQDLENYCPQMSFTYNAIGSDGTKNYGGYSENIVVDQRFVLRFPENLPSDSGAPLLCAGITVYSPMKYYGMTEAGKHLGVAGLGGLGHVAVKIGKAFGL 208          

HSP 2 Score: 66.6254 bits (161), Expect = 4.255e-82
Identity = 36/69 (52.17%), Postives = 46/69 (66.67%), Query Frame = 1
Query:  697 GADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQL-PLLRGGK 900
            GADSFLV+ D  +M+AA+G MD IIDT+SAVH L P++G +K  GK    G PEK     + PL+ G K
Sbjct:  228 GADSFLVTTDPQKMKAAIGTMDYIIDTISAVHALYPLLGLLKVNGKLIALGLPEKPLELPMFPLVLGRK 296          
BLAST of EY659268 vs. ExPASy Swiss-Prot
Match: MTDH_PETCR (Mannitol dehydrogenase (Fragment) OS=Petroselinum crispum GN=ELI3 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 8.427e-82
Identity = 117/184 (63.59%), Postives = 137/184 (74.46%), Query Frame = 3
Query:   87 VLSPFHFSRRATGEKDVTFKVTHCGICHSDLHLIKNEWGNAIYPIVPGHEIVGVVTEVGSKVSKFKVGDKVGVGCMVGSCRSCDSCAIDLENYCPKVIMTYASKYHDGTITYGGYSDTMVADEHFVVRIPEGAPLDATAPLLCAGITVYSPLRFYGLXQPXXXXXXXXXXXXXXXXXKFAKLWG 638
            +LSPF FSRRATG+ DV FKV +CG+CHSDLH++KNEWG   YPIVPGHEIVG VTEVGSKV KFKVGD VGVGC+VGSC SC++C  D EN C K + TYA    DG+ITYGGY+D+MVAD+HFV+R PE  PLD+ APLLCAGIT YSPLR++GL +P                 K AK +G
Sbjct:    1 ILSPFKFSRRATGDNDVRFKVLYCGVCHSDLHMVKNEWGMTTYPIVPGHEIVGRVTEVGSKVEKFKVGDAVGVGCLVGSCLSCENCDDDSENNCAKQVQTYAFTNVDGSITYGGYADSMVADQHFVLRWPENLPLDSGAPLLCAGITTYSPLRYHGLDKPGTKVGVVGLGGLGHVAVKMAKAFG 184          

HSP 2 Score: 74.7146 bits (182), Expect = 8.427e-82
Identity = 39/71 (54.93%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  691 RXGADSFLVSRDQDEMQAAMGHMDGIIDTVSAVHPLMPVIGTVKSQGKXCTXGAPEKH*SYQL-PLLRGGK 900
            + GAD FLVS D D+MQAA G + GIIDTVSA+HP++P++G +K  GK    GAPEK     + PLL G K
Sbjct:  203 KLGADEFLVSSDSDQMQAATGTLHGIIDTVSALHPVVPLLGLLKVNGKLVMVGAPEKPLELPVFPLLMGRK 273          

HSP 3 Score: 23.483 bits (49), Expect = 8.427e-82
Identity = 13/32 (40.62%), Postives = 18/32 (56.25%), Query Frame = 2
Query:  617 QIRKAMGVNVTVISTXP*QXSEARDVLALIPF 712
            ++ KA G +VTVIST   +  EA + L    F
Sbjct:  178 KMAKAFGAHVTVISTSESKKQEALEKLGADEF 209          
The following BLAST results are available for this feature:
BLAST of EY659268 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 105
Match NameE-valueIdentityDescription
MTDH_FRAAN4.506e-10368.78Probable mannitol dehydrogenase OS=Fragaria ananas... [more]
MTDH_MESCR6.375e-10269.61Probable mannitol dehydrogenase OS=Mesembryanthemu... [more]
GEDH1_OCIBA1.553e-9064.25Geraniol dehydrogenase 1 OS=Ocimum basilicum GN=GE... [more]
CADH8_ARATH9.909e-9065.48Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis th... [more]
MTDH_APIGR2.088e-8763.29Mannitol dehydrogenase OS=Apium graveolens GN=MTD ... [more]
MTDH_MEDSA8.016e-8657.69Probable mannitol dehydrogenase OS=Medicago sativa... [more]
CADH7_ARATH8.674e-8562.44Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis th... [more]
CADH6_ARATH2.985e-8358.42Probable cinnamyl alcohol dehydrogenase 6 OS=Arabi... [more]
CADH9_ARATH4.255e-8256.25Probable cinnamyl alcohol dehydrogenase 9 OS=Arabi... [more]
MTDH_PETCR8.427e-8263.59Mannitol dehydrogenase (Fragment) OS=Petroselinum ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659268 ID=EY659268|Name=EY659268|organism=Citrus sinensis|type=EST|length=901bp
ATTAAATTCATTCTGAAATGGGGCAAGCACCGGAGCAAGAGCACCCTAAG
AACGCCTTTGGATGGGCTGCCAGGGACACTTCTGGCGTTCTCTCCCCCTT
TCACTTCTCCAGAAGAGCAACGGGAGAGAAGGATGTGACATTCAAAGTAA
CTCACTGTGGGATATGCCATTCAGATCTTCACTTGATCAAAAATGAATGG
GGCAATGCCATTTACCCAATCGTCCCCGGACATGAGATTGTGGGCGTAGT
GACAGAGGTCGGAAGCAAAGTGAGTAAATTCAAAGTCGGAGACAAAGTGG
GAGTAGGATGCATGGTGGGATCATGCCGCTCTTGTGATAGCTGCGCCATT
GATCTTGAGAACTACTGCCCCAAAGTTATAATGACCTATGCCAGCAAGTA
CCATGATGGAACCATCACATACGGAGGCTACTCTGACACTATGGTTGCCG
ATGAGCACTTTGTGGTCCGTATTCCTGAAGGCGCACCACTTGACGCCACT
GCCCCTCTCCTCTGTGCTGGTATCACAGTCTACAGTCCGTTGAGATTCTA
TGGACTCGNACAGCCTGGTATGCATGTGGGTGTTGTCGGCTTGGGCGGTC
TATGCCATGTCGCTGTCAAATTCGCAAAGCTATGGGGGTTAATGTGACTG
TGATCAGTACCTNCCCCTAGCAGATNAGTGAAGCCCGTGACGTNCTGGCG
CTGATTCCTTTTTGGTCAGTCGTGATCAAGATGAGATGCAGGCTGCCATG
GGGCACATGGATGGTATCATCGATACAGTATCTGCAGTTCACCCGCTAAT
GCCCGTGATTGGNACTGTGAAATCTCAAGGAAAGNNCTGTACTNCTGGTG
CACCCGAGAAGCACTAAAGCTACCAGCTTCCCCTGCTACGGGGAGGAAAA
T
back to top