EY659267

Overview
NameEY659267
Unique NameEY659267
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length934
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659267_ssr187 microsatellite EY659267_ssr187:187..198. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_RAT (Signal peptidase complex catalytic subunit SEC11A OS=Rattus norvegicus GN=Sec11a PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMLITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_PONAB (Signal peptidase complex catalytic subunit SEC11A OS=Pongo abelii GN=SEC11A PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_MOUSE (Signal peptidase complex catalytic subunit SEC11A OS=Mus musculus GN=Sec11a PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_HUMAN (Signal peptidase complex catalytic subunit SEC11A OS=Homo sapiens GN=SEC11A PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_CANFA (Signal peptidase complex catalytic subunit SEC11A OS=Canis familiaris GN=SEC11A PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11A_BOVIN (Signal peptidase complex catalytic subunit SEC11A OS=Bos taurus GN=SEC11A PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.593e-27
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++ GMIV+SAL+IWK LM ITGSESP+VVVLSGSMEP F RGD+LFL +  +DPIR GEIVVF ++GREIPIVHRV+K++
Sbjct:   10 VRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIH 102          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11C_PONAB (Signal peptidase complex catalytic subunit SEC11C OS=Pongo abelii GN=SEC11C PE=2 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 7.835e-27
Identity = 61/93 (65.59%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            +K +  RQ+  Q ++  MIV+SAL+IWK L+ +TGSESP+VVVLSGSMEP F RGD+LFL +  +DPIRAGEIVVF V+GR+IPIVHRVIKV+
Sbjct:   22 LKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVH 114          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11C_HUMAN (Signal peptidase complex catalytic subunit SEC11C OS=Homo sapiens GN=SEC11C PE=1 SV=3)

HSP 1 Score: 121.324 bits (303), Expect = 7.835e-27
Identity = 61/93 (65.59%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            +K +  RQ+  Q ++  MIV+SAL+IWK L+ +TGSESP+VVVLSGSMEP F RGD+LFL +  +DPIRAGEIVVF V+GR+IPIVHRVIKV+
Sbjct:   22 LKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVH 114          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11C_RAT (Signal peptidase complex catalytic subunit SEC11C OS=Rattus norvegicus GN=Sec11c PE=2 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 1.745e-26
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++  MIV+SAL+IWK L+ +TGSESP+VVVLSGSMEP F RGD+LFL +  +DPIRAGEIVVF V+GR+IPIVHRVIKV+
Sbjct:   22 LRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVH 114          
BLAST of EY659267 vs. ExPASy Swiss-Prot
Match: SC11C_MOUSE (Signal peptidase complex catalytic subunit SEC11C OS=Mus musculus GN=Sec11c PE=2 SV=3)

HSP 1 Score: 120.168 bits (300), Expect = 1.745e-26
Identity = 60/93 (64.52%), Postives = 77/93 (82.80%), Query Frame = 2
Query:   71 IKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGDILFL-HMSKDPIRAGEIVVFNVDGREIPIVHRVIKVN 346
            ++ +  RQ+  Q ++  MIV+SAL+IWK L+ +TGSESP+VVVLSGSMEP F RGD+LFL +  +DPIRAGEIVVF V+GR+IPIVHRVIKV+
Sbjct:   22 LRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVH 114          
The following BLAST results are available for this feature:
BLAST of EY659267 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
SC11A_RAT4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11A_PONAB4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11A_MOUSE4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11A_HUMAN4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11A_CANFA4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11A_BOVIN4.593e-2764.52Signal peptidase complex catalytic subunit SEC11A ... [more]
SC11C_PONAB7.835e-2765.59Signal peptidase complex catalytic subunit SEC11C ... [more]
SC11C_HUMAN7.835e-2765.59Signal peptidase complex catalytic subunit SEC11C ... [more]
SC11C_RAT1.745e-2664.52Signal peptidase complex catalytic subunit SEC11C ... [more]
SC11C_MOUSE1.745e-2664.52Signal peptidase complex catalytic subunit SEC11C ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-008-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659267 ID=EY659267|Name=EY659267|organism=Citrus sinensis|type=EST|length=934bp
CCACGCGTCCGCATAAACATAAACAGAGAAGATAAAAAGAATGGGGTGGA
TCGGGGAAAGCATATAGTCGATCAAGTCCCTTCAGATCCGCCAGGTCCTT
ACTCAGGGCGTCAGTCTTGGTATGATTGTTACATCTGCTTTAATAATATG
GAAGGCATTGATGTGCATCACTGGCAGTGAATCTCCTGTTGTTGTTGTTC
TTTCTGGAAGCATGGAACCTGGCTTCAAGAGGGGAGATATTTTGTTCTTG
CATATGAGTAAAGATCCTATTCGTGCTGGAGAGATTGTTGTTTTTAATGT
TGATGGCCGGGAAATTCCAATTGTCCATCGAGTTATTAAGGTGAATATTT
TATTGACCTTATTCTTTGAATTGACGATACAACCTTGCTGCCTATAATGT
GCTTATCTGTGCTGGTAAATACTTGCTTTTTGATTATATGCGCTTACCAT
GTGCTTGACCACCTTCTTAATTTGTGATATTTTCCTAAAGATTGCTATGT
TAGGACTAGGTGATAGATACATTGAGCCTTTTACTTTCATGATTCTTTTA
GTTTTTTGAGGATCCTTTGTCTTCTTGAAACTTTCTGTACTTTATATGTA
CTAGAGCTCATTTTCTTGTACTAACCAAGGTTCGTCTGTCTAACCACAAG
TAGAAAGGCCCTCTTGTTTTTTTCTCGGGTGCCTTTTGCCTGAAACAGTG
TCTANCCATCCTAATATTAAATTGGATGGCGGCTCACGAACGGCAAGATA
CTGGGGAAGTTGGAGGCCTAACAAAGGGAATACCATTATGGGGATAAAGG
TTTTGTTTGCTAAAGGCAGCTTTGGCTTAGCGACAACTTTATGGGCAGAC
TGGGGGGAAAAACCTTATCCAACCTTTGGTCTCCGGATTTTTCATCTATA
CGAGACATTATCATTTGATGACCAGGAGGAGTGA
back to top