EY659240
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY659240 vs. ExPASy Swiss-Prot
Match: ILL3_ORYSJ (IAA-amino acid hydrolase ILR1-like 3 OS=Oryza sativa subsp. japonica GN=ILL3 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 2.267e-12 Identity = 33/56 (58.93%), Postives = 44/56 (78.57%), Query Frame = 2 Query: 716 QVIEMQAAVHQCSATIDFMEEKMXHYPGTVNDEKMYEHXQRVXASMVGEPNVHLTP 883 +VIE QAAV++C+A +DFME+K+ YP TVNDE+MY H + V SM+GE NV L+P Sbjct: 286 EVIEGQAAVNRCTAAVDFMEDKLPPYPATVNDEEMYAHAKAVAESMLGEANVKLSP 341
BLAST of EY659240 vs. ExPASy Swiss-Prot
Match: ILL4_ORYSJ (IAA-amino acid hydrolase ILR1-like 4 OS=Oryza sativa subsp. japonica GN=ILL4 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 1.470e-11 Identity = 32/56 (57.14%), Postives = 43/56 (76.79%), Query Frame = 2 Query: 716 QVIEMQAAVHQCSATIDFMEEKMXHYPGTVNDEKMYEHXQRVXASMVGEPNVHLTP 883 +VIE QAAV++C+A +DFME+K+ YP TVNDE MY H + V SM+GE NV ++P Sbjct: 281 EVIEGQAAVNRCTAAVDFMEDKLRPYPATVNDEGMYAHAKAVAESMLGEANVTVSP 336
BLAST of EY659240 vs. ExPASy Swiss-Prot
Match: ILL5_ARATH (IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 3.274e-11 Identity = 34/46 (73.91%), Postives = 37/46 (80.43%), Query Frame = -3 Query: 41 SGRFTAVIKGKGGHAAMPQDTRDPVLAASFAILTLQHIVSRETDPL 178 SGRF A I GKGGHAA+PQ DPVLAAS IL+LQH+VSRE DPL Sbjct: 215 SGRFKATISGKGGHAALPQFAIDPVLAASNVILSLQHLVSREADPL 260
BLAST of EY659240 vs. ExPASy Swiss-Prot
Match: ILL1_ARATH (IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 7.294e-11 Identity = 32/45 (71.11%), Postives = 38/45 (84.44%), Query Frame = -3 Query: 44 SGRFTAVIKGKGGHAAMPQDTRDPVLAASFAILTLQHIVSRETDP 178 +G F AVI GKGGHAA+PQ T DPV+AAS +L+LQH+VSRETDP Sbjct: 217 AGAFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDP 261 The following BLAST results are available for this feature:
BLAST of EY659240 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY659240 ID=EY659240; Name=EY659240; organism=Citrus sinensis; type=EST; length=888bpback to top |