EY659233

Overview
NameEY659233
Unique NameEY659233
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length817
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC4_SOLLC (Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.729e-47
Identity = 52/56 (92.86%), Postives = 56/56 (100.00%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV+I+FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 96.6709 bits (239), Expect = 1.729e-47
Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPPTSCSAGP AEDMFHWQATIMGP+DSPYA
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPTDSPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC9_ARATH (SUMO-conjugating enzyme UBC9 OS=Arabidopsis thaliana GN=UBC9 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.254e-47
Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 96.6709 bits (239), Expect = 2.254e-47
Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPPTSCSAGP AEDMFHWQATIMGPSDSPY+
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC10_ARATH (Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.937e-47
Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 96.2857 bits (238), Expect = 2.937e-47
Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPPTSCSAGP AEDMFHWQATIMGPS+SPYA
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSESPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC28_ARATH (Ubiquitin carrier protein E2 28 OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.937e-47
Identity = 51/56 (91.07%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKVAFRTKVFHPN+NSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 96.6709 bits (239), Expect = 2.937e-47
Identity = 44/46 (95.65%), Postives = 45/46 (97.83%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPPTSCSAGP AEDMFHWQATIMGPSDSPY+
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPSDSPYS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC8_ARATH (Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 1.440e-46
Identity = 52/56 (92.86%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 93.9745 bits (232), Expect = 1.440e-46
Identity = 42/46 (91.30%), Postives = 45/46 (97.83%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPPTSCSAGP AEDMFHWQATIMGP++SPY+
Sbjct:    1 MASKRILKELKDLQKDPPTSCSAGPVAEDMFHWQATIMGPAESPYS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC11_ARATH (Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 5.873e-45
Identity = 49/56 (87.50%), Postives = 56/56 (100.00%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV+I+FPPDYPFKPPKV+F+TKV+HPNINSNGSICLDILKEQWSPALTISK++
Sbjct:   48 GVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103          

HSP 2 Score: 91.6633 bits (226), Expect = 5.873e-45
Identity = 41/46 (89.13%), Postives = 44/46 (95.65%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRILKELKDLQKDPP++CSAGP AEDMFHWQATIMGP +SPYA
Sbjct:    1 MASKRILKELKDLQKDPPSNCSAGPVAEDMFHWQATIMGPPESPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC30_ARATH (Ubiquitin carrier protein E2 30 OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.172e-42
Identity = 50/56 (89.29%), Postives = 55/56 (98.21%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKVAFRTKV+HPNINSNGSICLDILKEQWSPALT+SK++
Sbjct:   48 GVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVL 103          

HSP 2 Score: 82.4185 bits (202), Expect = 1.172e-42
Identity = 36/46 (78.26%), Postives = 41/46 (89.13%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MASKRI KEL+DLQ+DPP SCSAGP  +DMF WQATIMGP+DSP+A
Sbjct:    1 MASKRINKELRDLQRDPPVSCSAGPTGDDMFQWQATIMGPADSPFA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC29_ARATH (Ubiquitin carrier protein E2 29 OS=Arabidopsis thaliana GN=UBC29 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.172e-42
Identity = 49/56 (87.50%), Postives = 54/56 (96.43%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVFLV I+FPPDYPFKPPKV FRTKVFHPNINSNG+ICLDILK+QWSPALTISK++
Sbjct:   48 GVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDILKDQWSPALTISKVL 103          

HSP 2 Score: 85.5001 bits (210), Expect = 1.172e-42
Identity = 36/46 (78.26%), Postives = 43/46 (93.48%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MA++RILKELK+LQ+DPP SCSAGP  EDMFHWQATIMGP++SPY+
Sbjct:    1 MATRRILKELKELQRDPPVSCSAGPTGEDMFHWQATIMGPNESPYS 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UBC1_MAGGR (Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 5.589e-39
Identity = 43/56 (76.79%), Postives = 52/56 (92.86%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF +AI+FP DYPFKPPKV F T+++HPNINSNGSICLDIL++QWSPALTISK++
Sbjct:   48 GVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103          

HSP 2 Score: 82.4185 bits (202), Expect = 5.589e-39
Identity = 37/46 (80.43%), Postives = 40/46 (86.96%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPYA 329
            MA KRI KEL DL +DPP+SCSAGP  ED+FHWQATIMGPSDSPYA
Sbjct:    1 MALKRINKELTDLGRDPPSSCSAGPVGEDLFHWQATIMGPSDSPYA 46          
BLAST of EY659233 vs. ExPASy Swiss-Prot
Match: UB2D4_HUMAN (Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens GN=UBE2D4 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.098e-38
Identity = 43/56 (76.79%), Postives = 51/56 (91.07%), Query Frame = 2
Query:  338 GVFLVAINFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKMV 505
            GVF + I+FP DYPFKPPKVAF TK++HPNINSNGSICLDIL+ QWSPALT+SK++
Sbjct:   48 GVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVL 103          

HSP 2 Score: 79.7221 bits (195), Expect = 2.098e-38
Identity = 34/45 (75.56%), Postives = 38/45 (84.44%), Query Frame = 3
Query:  192 MASKRILKELKDLQKDPPTSCSAGPAAEDMFHWQATIMGPSDSPY 326
            MA KRI KEL DLQ+DPP  CSAGP  +D+FHWQATIMGP+DSPY
Sbjct:    1 MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPY 45          
The following BLAST results are available for this feature:
BLAST of EY659233 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 160
Match NameE-valueIdentityDescription
UBC4_SOLLC1.729e-4792.86Ubiquitin-conjugating enzyme E2-17 kDa OS=Solanum ... [more]
UBC9_ARATH2.254e-4792.86SUMO-conjugating enzyme UBC9 OS=Arabidopsis thalia... [more]
UBC10_ARATH2.937e-4792.86Ubiquitin-conjugating enzyme E2 10 OS=Arabidopsis ... [more]
UBC28_ARATH2.937e-4791.07Ubiquitin carrier protein E2 28 OS=Arabidopsis tha... [more]
UBC8_ARATH1.440e-4692.86Ubiquitin-conjugating enzyme E2 8 OS=Arabidopsis t... [more]
UBC11_ARATH5.873e-4587.50Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis ... [more]
UBC30_ARATH1.172e-4289.29Ubiquitin carrier protein E2 30 OS=Arabidopsis tha... [more]
UBC29_ARATH1.172e-4287.50Ubiquitin carrier protein E2 29 OS=Arabidopsis tha... [more]
UBC1_MAGGR5.589e-3976.79Ubiquitin-conjugating enzyme E2-16 kDa OS=Magnapor... [more]
UB2D4_HUMAN2.098e-3876.79Ubiquitin-conjugating enzyme E2 D4 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659233 ID=EY659233|Name=EY659233|organism=Citrus sinensis|type=EST|length=817bp
TCTTTCTCGACGATATTTGTGTTGAAGAACAAAACAGGGGTTGTTAGAGG
AGCGAGGCGGGGGCGGCTTGACGACGTAGATCTGCTTCACCGTTTCGCTT
TCTCGACGCTATTACCCTACGATCCTGTTCTCTGCCGCGCAAGGTCTTAA
GGTTCGTTGTAGCTTTAATTTTAATAACCCCTTGAAGAGTCATGGCTTCA
AAGCGTATTTTGAAGGAACTCAAGGATCTGCAAAAGGATCCTCCCACATC
TTGCAGCGCTGGCCCTGCGGCTGAAGACATGTTCCACTGGCAAGCCACAA
TTATGGGCCCTTCTGATAGCCCATATGCTGATATGCAGGTGTATTTTTAG
TTGCCATTAATTTTCCTCCTGATTATCCTTTCAAGCCCCCAAAGGTTGCT
TTTAGGACCAAGGTCTTCCACCCGAACATCAACAGCAATGGAAGCATCTG
TCTTGATATCCTTAAAGAACAGTGGAGTCCTGCGCTTACCATTTCAAAGA
TGGTGAAGTTGTAAACGAATGCGCGATATAGTGCGGACGATGATTGGTTG
TTGAATACATTTCATGTGATATTGGCCATTCTCAGAACCTAACTCACTCT
GTAAATGCTTGAGCCTTTTGACTAAAGATTATTCAATGTATTGCCGCTGG
AAGATGGTATTGCTNCTGGNAAGTCTGCTGNTGGAATATTTNCATTTTAT
CTTGGNAAGTNNNTGTGGAGAGCTTGGCTCGGTGGCCGGAATTTNNGATA
CTNNTATGGNNAGTTAATGGGAATTTAACTATNGTTTTATATTTGGCATT
CCTTTTTTTTTTATTTA
back to top