EY659232

Overview
NameEY659232
Unique NameEY659232
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length878
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659232_ssr158 microsatellite EY659232_ssr158:158..175. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP12_ARATH (Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2 PE=1 SV=2)

HSP 1 Score: 277.33 bits (708), Expect = 7.783e-74
Identity = 147/220 (66.82%), Postives = 172/220 (78.18%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF-------QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKW 843
            SVPF+QKLMAE+LGTYF+IFAGCA+V VN  ++K V+LPGI+IVWGL VMVLVYSLGHISGAHFNP+VTIA A+C RFP KQVP Y++ QV+GSTLAA TLRLLF         K D F  TL +GSN+Q+FV+EFIITFYLMFVISGVATDNRAIGELAGLAVG TVL NV+ A P++GASMN   S G +      +GLWIY+V+ + G   AV   W
Sbjct:   47 SVPFLQKLMAEVLGTYFLIFAGCAAVAVNTQHDKAVTLPGIAIVWGLTVMVLVYSLGHISGAHFNPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDQDVCSGKHDVFVGTLPSGSNLQSFVIEFIITFYLMFVISGVATDNRAIGELAGLAVGSTVLLNVIIAGPVSGASMNPGRSLGPAMVYSCYRGLWIYIVSPIVG---AVSGAW 263          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP11_ARATH (Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 4.722e-71
Identity = 145/260 (55.77%), Postives = 180/260 (69.23%), Query Frame = 1
Query:   70 MADNSGTGSNGVC--VTFKDCEDAIQNCXXXXXXXXXXXCDTKDSVY-FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF-------QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            MAD SG G       V   + +D +++               +DS+   SVPF+QKL+AE LGTYF++F GCASVVVN+ N+ +V+LPGI+IVWGL +MVL+YSLGHISGAH NP+VTIA A+C RFP KQVP Y++ QV+GSTLAA TLRLLF         K D F  +   GS++QAF MEFI+TFYLMF+ISGVATDNRAIGELAGLA+G TVL NV+ A P++ ASMN   S G +      KG+WIY+VA   G
Sbjct:    1 MADISGNGYGNAREEVVMVNLKDEVEHQQEMEDIHNPRPLKKQDSLLSVSVPFLQKLIAEFLGTYFLVFTGCASVVVNMQNDNVVTLPGIAIVWGLTIMVLIYSLGHISGAHINPAVTIAFASCGRFPLKQVPAYVISQVIGSTLAAATLRLLFGLDHDVCSGKHDVFIGSSPVGSDLQAFTMEFIVTFYLMFIISGVATDNRAIGELAGLAIGSTVLLNVLIAAPVSSASMNPGRSLGPALVYGCYKGIWIYLVAPTLG 260          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP11_ORYSJ (Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.794e-70
Identity = 131/221 (59.28%), Postives = 168/221 (76.02%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWGKFLTAF 864
            FSVPF+QK++AEI GTYF+IFAGC +V +N +    ++ PG++IVWGL VMV+VY++GHISGAHFNP+VT+A ATC+RFPW+QVP Y   Q+LG+TLAAGTLRL+F  + + F  TL AGS++Q+ V+EFIITFYLMFVISGVATDNRAIGELAGLAVG T+L NV+ A PI+GASMN   S G +      + +W+Y+V  + G   AV   W   +  F
Sbjct:   42 FSVPFIQKIIAEIFGTYFLIFAGCGAVTINQSKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATCRRFPWRQVPAYAAAQMLGATLAAGTLRLMFGGRHEHFPGTLPAGSDVQSLVLEFIITFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPISGASMNPARSLGPAMIGGEYRSIWVYIVGPVAG---AVAGAWAYNIIRF 259          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP11_MAIZE (Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.572e-66
Identity = 125/220 (56.82%), Postives = 163/220 (74.09%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWGKFLTAF 864
            SVPF+QK++AEI GTYF++FAGC +V +N +    ++ PG++IVWGL VMV+VY++GHISGAHFNP+VT+A AT  RFPW+Q+P Y+L Q+LG+TLA+GTLRL+F  + + F  TL  GS +Q+ V+E I TFYLMFVISGVATDNRAIGELAGLAVG T+L NV+ A P++GASMN   S G +  S     +W+Y+V  + G   AV   W   L  F
Sbjct:   39 SVPFIQKIIAEIFGTYFLMFAGCGAVTINASKNGQITFPGVAIVWGLAVMVMVYAVGHISGAHFNPAVTLAFATSGRFPWRQLPAYVLAQMLGATLASGTLRLMFGGRHEHFPGTLPTGSEVQSLVIEIITTFYLMFVISGVATDNRAIGELAGLAVGATILLNVLIAGPVSGASMNPARSVGPALVSGEYTSIWVYVVGPVVG---AVAGAWAYNLIRF 255          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NO26_SOYBN (Nodulin-26 OS=Glycine max PE=1 SV=2)

HSP 1 Score: 252.677 bits (644), Expect = 2.053e-66
Identity = 124/204 (60.78%), Postives = 161/204 (78.92%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            SVPF+QKL+AE +GTYF+IFAGCAS+VVN N   +++ PGI+IVWGLV+ VLVY++GHISG HFNP+VTIA A+ +RFP  QVP Y++ Q+LGS LA+GTLRLLF    DQF+ T+  G+N+QAFV EFI+TF+LMFVI GVATDNRA+GE AG+A+G T+L NV+   P+TGASMN   S G +      +G+WIY++A + G
Sbjct:   33 SVPFLQKLVAEAVGTYFLIFAGCASLVVNENYYNMITFPGIAIVWGLVLTVLVYTVGHISGGHFNPAVTIAFASTRRFPLIQVPAYVVAQLLGSILASGTLRLLFMGNHDQFSGTVPNGTNLQAFVFEFIMTFFLMFVICGVATDNRAVGEFAGIAIGSTLLLNVIIGGPVTGASMNPARSLGPAFVHGEYEGIWIYLLAPVVG 236          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP13_ORYSJ (Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica GN=NIP1-3 PE=3 SV=2)

HSP 1 Score: 245.743 bits (626), Expect = 2.510e-64
Identity = 128/221 (57.92%), Postives = 155/221 (70.14%), Query Frame = 1
Query:  205 FSVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGDCXAVGYKWGKFLTAF 864
            FSV F QK++AEILGT+F+IFAGCA+V VN      V+ PGI I WGL VMV+VYS+GHISGAH NP+VT+A ATC RFPW++VP Y   QV GS  A+  LR LF    + F  T  AGS++Q+  MEFIITFYLMFV+SGVATDNRAIGELAGLAVG TVL NV+FA PI+GASMN   + G +       G+W+Y+   ++G   AV   W   L  F
Sbjct:   48 FSVQFAQKVIAEILGTFFLIFAGCAAVAVNKRTGGTVTFPGICITWGLAVMVMVYSVGHISGAHLNPAVTLAFATCGRFPWRRVPAYAAAQVAGSAAASAALRALFGGAPEHFFGTAPAGSDVQSLAMEFIITFYLMFVVSGVATDNRAIGELAGLAVGATVLVNVLFAGPISGASMNPARTIGPAIILGRYTGIWVYIAGPVFG---AVAGAWAYNLIRF 265          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP12_ORYSJ (Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica GN=NIP1-2 PE=2 SV=2)

HSP 1 Score: 235.728 bits (600), Expect = 2.597e-61
Identity = 131/236 (55.51%), Postives = 161/236 (68.22%), Query Frame = 1
Query:  208 SVPFMQK-------------LMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF------QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYGD-CXAVGYKWGKF 852
            SV FMQK             ++AEILGTYFMIFAGC +VVVN +    V+ PGI  VWGLVVMVLVY++ HISGAHFNP+VT+A ATC RF WKQVP Y++ QVLGST+A+ TLR++F         +  F  T  AGS  QA  +EF+I+F+LMFV+SGVATDNRAIGELAGLAVG TV  NV+FA P+TGASMN   S G +  +    G+W+Y+ A + G  C A  Y   +F
Sbjct:   46 SVQFMQKVHPWCMCMNKNLLILAEILGTYFMIFAGCGAVVVNQSTGGAVTFPGICAVWGLVVMVLVYTVSHISGAHFNPAVTVAFATCGRFRWKQVPSYVVAQVLGSTMASLTLRVVFGGGGGGARGEHLFFGTTPAGSMAQAAALEFVISFFLMFVVSGVATDNRAIGELAGLAVGATVAVNVLFAGPVTGASMNPARSLGPAMVAGRYGGVWVYVAAPVSGTVCGAWAYNLLRF 281          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP31_ARATH (Aquaporin NIP3-1 OS=Arabidopsis thaliana GN=NIP3-1 PE=2 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 1.248e-55
Identity = 113/211 (53.55%), Postives = 151/211 (71.56%), Query Frame = 1
Query:  208 SVPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLF-------QEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            SV F+QKL+ E +GT+ MIFAGC+++VVN    K V+LPGI++VWGLVV V++YS+GH+SGAHFNP+V+IA A+ K+FP+ QVP YI  Q+LGSTLAA  LRL+F         K D +  T  + SN  +FVMEFI TF LMFVIS VATD RA G  AG+A+G T++ +++F+ PI+GASMN   S G +      K LW+Y+V+ + G
Sbjct:   38 SVSFVQKLIGEFVGTFTMIFAGCSAIVVNETYGKPVTLPGIALVWGLVVTVMIYSIGHVSGAHFNPAVSIAFASSKKFPFNQVPGYIAAQLLGSTLAAAVLRLVFHLDDDVCSLKGDVYVGTYPSNSNTTSFVMEFIATFNLMFVISAVATDKRATGSFAGIAIGATIVLDILFSGPISGASMNPARSLGPALIWGCYKDLWLYIVSPVIG 248          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP1_NICAL (Probable aquaporin NIP-type OS=Nicotiana alata PE=2 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 2.129e-55
Identity = 114/206 (55.34%), Postives = 146/206 (70.87%), Query Frame = 1
Query:  211 VPFMQKLMAEILGTYFMIFAGCASVVVNLNNEKI---VSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            V  +QKL+AE +GTYF+IFAGC SV VN    KI   V+ PGI + WGL+VMV+VY++G+ISGAHFNP+VTI  +   RFPWKQVP YI+ Q++GS LA+GTL LLF      +  T+  GSN Q+  +E II+F LMFVISGVATD+RAIG++AG+AVG T+  NV  A PI+GASMN   S G +       GLW+Y+V  + G
Sbjct:   39 VVILQKLIAEAIGTYFVIFAGCGSVAVN----KIYGSVTFPGICVTWGLIVMVMVYTVGYISGAHFNPAVTITFSIFGRFPWKQVPLYIIAQLMGSILASGTLALLFDVTPQAYFGTVPVGSNGQSLAIEIIISFLLMFVISGVATDDRAIGQVAGIAVGMTITLNVFVAGPISGASMNPARSIGPAIVKHVYTGLWVYVVGPIIG 240          
BLAST of EY659232 vs. ExPASy Swiss-Prot
Match: NIP41_ARATH (Putative aquaporin NIP4-1 OS=Arabidopsis thaliana GN=NIP4-1 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 8.092e-55
Identity = 109/199 (54.77%), Postives = 141/199 (70.85%), Query Frame = 1
Query:  223 QKLMAEILGTYFMIFAGCASVVVNLNNEKIVSLPGISIVWGLVVMVLVYSLGHISGAHFNPSVTIAHATCKRFPWKQVPPYILCQVLGSTLAAGTLRLLFQEKQDQFA*TLXAGSNIQAFVMEFIITFYLMFVISGVATDNRAIGELAGLAVGFTVLANVMFARPITGASMNXQES-GASNCSKSDKGLWIYMVAHLYG 816
            QKL+AE++GTYF++F+GC  VVVN+     ++ PGI + WGL+VMV++YS GHISGAHFNP+VT+  A  +RFPW QVP YI  Q  GS LA+ TLRL+F+   + F  T  A S  +A V E II+F LMFVISGVATDNRA+GELAG+AVG T++ NV  A PI+GASMN   S G +      K +W+Y+V  + G
Sbjct:   43 QKLIAEMIGTYFIVFSGCGVVVVNVLYGGTITFPGICVTWGLIVMVMIYSTGHISGAHFNPAVTVTFAIFRRFPWHQVPLYIGAQFAGSLLASLTLRLMFKVTPEAFFGTTPADSPARALVAEIIISFLLMFVISGVATDNRAVGELAGIAVGMTIMVNVFVAGPISGASMNPARSLGPALVMGVYKHIWVYIVGPVLG 241          
The following BLAST results are available for this feature:
BLAST of EY659232 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 137
Match NameE-valueIdentityDescription
NIP12_ARATH7.783e-7466.82Aquaporin NIP1-2 OS=Arabidopsis thaliana GN=NIP1-2... [more]
NIP11_ARATH4.722e-7155.77Aquaporin NIP1-1 OS=Arabidopsis thaliana GN=NIP1-1... [more]
NIP11_ORYSJ1.794e-7059.28Aquaporin NIP1-1 OS=Oryza sativa subsp. japonica G... [more]
NIP11_MAIZE1.572e-6656.82Aquaporin NIP1-1 OS=Zea mays GN=NIP1-1 PE=2 SV=1[more]
NO26_SOYBN2.053e-6660.78Nodulin-26 OS=Glycine max PE=1 SV=2[more]
NIP13_ORYSJ2.510e-6457.92Aquaporin NIP1-3 OS=Oryza sativa subsp. japonica G... [more]
NIP12_ORYSJ2.597e-6155.51Aquaporin NIP1-2 OS=Oryza sativa subsp. japonica G... [more]
NIP31_ARATH1.248e-5553.55Aquaporin NIP3-1 OS=Arabidopsis thaliana GN=NIP3-1... [more]
NIP1_NICAL2.129e-5555.34Probable aquaporin NIP-type OS=Nicotiana alata PE=... [more]
NIP41_ARATH8.092e-5554.77Putative aquaporin NIP4-1 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-H02-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659232 ID=EY659232|Name=EY659232|organism=Citrus sinensis|type=EST|length=878bp
GAATCACTGTGCCTTTGTCTGTCCACTTTGCTCTCCGATCACTGTGCCTT
GATCCTATATAGATAGATCATGGCCGATAATTCAGGGACAGGGAGCAATG
GAGTTTGTGTAACATTCAAAGATTGTGAAGATGCCATTCAGAATTGCCCT
TCCTCTGCTCCTCCTCCTCCTCCTCCTTCATGCGACACAAAGGACTCCGT
ATATTTTTCAGTACCCTTCATGCAAAAGTTGATGGCGGAGATTTTGGGGA
CATATTTTATGATATTCGCGGGATGTGCATCGGTGGTGGTGAATCTGAAC
AATGAAAAGATAGTGTCGCTTCCAGGAATATCAATTGTGTGGGGACTTGT
TGTGATGGTGCTTGTTTACTCCCTCGGTCACATCTCCGGCGCCCATTTCA
ATCCTTCTGTCACCATTGCTCATGCCACCTGCAAACGTTTTCCCTGGAAA
CAGGTTCCGCCTTATATACTATGCCAAGTTCTGGGATCAACGTTGGCTGC
GGGAACACTTCGGTTACTGTTTCAAGAAAAACAGGATCAGTTCGCATGAA
CACTTNCAGCTGGCTCCAATATTCAGGCGTTTGTGATGGAGTTCATTATC
ACCTTCTACCTCATGTTTGTCATATCCGGTGTCGCCACCGATAACAGAGC
TATAGGCGAGCTTGCAGGTCTCGCTGTTGGTTTCACAGTGCTTGCTAATG
TCATGTTTGCCCGGCCCATAACAGGAGCATCAATGAACCANCAAGAATCT
GGGGCCAGCAATTGTTCAAAGTCAGACAAGGGTTTGTGGATATACATGGT
GGCGCACCTTTATGGCGACTGCANGGCCGTGGGTTACAAATGGGGGAAAT
TTCTGACAGCCTTTGGGAAAATTACAAA
back to top