EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_BACSU (3-oxoacyl-[acyl-carrier-protein] reductase OS=Bacillus subtilis GN=fabG PE=3 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 8.631e-23
Identity = 77/237 (32.49%), Postives = 123/237 (51.90%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA-ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   LDLAK+G  +V   +    +   + DEI        +A+AV+ DVS N   ++N ++     F  ID LVNNAG++      + + E+EW+ ++  NL G +  +K V  +M    + G +IN+SSI   S    PG   Y ++KAG+  +TK  + EL    I VN+I PG   +++T+ L K   + +   +  PL  FG     ++S+V +L  + +    G
Sbjct:   10 TGASRGIGRSIALDLAKSGANVVVNYSGNEAKANEVVDEIKSMGR---KAIAVKADVS-NPEDVQNMIKETLSVFSTIDILVNNAGITRD-NLIMRMKEDEWDDVININLKGVFNCTKAVTRQMMK-QRSGRIINVSSIVGVSGN--PGQANYVAAKAGVIGLTKSSAKELASRNITVNAIAPGFISTDMTDKLAKD--VQDEMLKQIPLARFGEPSD-VSSVVTFLASEGARYMTG 235          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG_BACME (Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 9.543e-22
Identity = 69/190 (36.32%), Postives = 109/190 (57.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAAR-RVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG+S+GLG+   +  A    ++V   R + D   S+ +EI K  G    A+AV+ DV+     I N VQ A + FG++D ++NNAG+   V S  +++  +WN ++ TNLTG++L S+       + + +G+VIN+SS+    +   P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEIKKVGGE---AIAVKGDVTVESDVI-NLVQSAIKEFGKLDVMINNAGLENPVSSH-EMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVH--EKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAES (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.079e-21
Identity = 73/237 (30.80%), Postives = 122/237 (51.48%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   D+ +++ +EI  +    V + A++ +V A G  ++  ++     FG +D LVNNAG++      + + E+EW+ ++ TNL G +   + V  +M    + G++IN++SI        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T  L   D L +      PL+ FG  D  + + V +L  D +    G
Sbjct:    8 TGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKG---VESFAIQANV-AKGDEVKEMIKEVVSQFGSVDVLVNNAGITKD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQML-RQRSGAIINLTSIVGAMGN--PGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDMTNAL--SDDLKDQMLEQIPLKRFG-EDTDIANTVAFLASDKAKYITG 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_STAEQ (3-oxoacyl-[acyl-carrier-protein] reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.079e-21
Identity = 73/237 (30.80%), Postives = 122/237 (51.48%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRI-VAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TGAS G+GR   L LA+ G  + V  A   D+ +++ +EI  +    V + A++ +V A G  ++  ++     FG +D LVNNAG++      + + E+EW+ ++ TNL G +   + V  +M    + G++IN++SI        PG   Y ++KAG+  +TK  + EL    I VN++ PG   S++T  L   D L +      PL+ FG  D  + + V +L  D +    G
Sbjct:    8 TGASRGIGRSIALQLAEEGYNVAVNYAGSKDKAEAVVEEIKAKG---VESFAIQANV-AKGDEVKEMIKEVVSQFGSVDVLVNNAGITKD-NLLMRMKEQEWDDVIDTNLKGVFNCIQKVTPQML-RQRSGAIINLTSIVGAMGN--PGQANYVATKAGVIGLTKTAARELASRGITVNAVAPGFIVSDMTNAL--SDDLKDQMLEQIPLKRFG-EDTDIANTVAFLASDKAKYITG 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHG1_BACME (Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.079e-21
Identity = 67/190 (35.26%), Postives = 109/190 (57.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAAR-RVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG+S+GLG+   +  A    ++V   R + +   S+ +EI K  G    A+AV+ DV+     I N VQ + + FG++D ++NNAG+   V S  +++  +WN ++ TNLTG++L S+       + + +G+VIN+SS+    +   P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGSSTGLGKAMAIRFATEKAKVVVNYRSKEEEANSVLEEIKKVGGE---AIAVKGDVTVESDVI-NLVQSSIKEFGKLDVMINNAGMENPVSSH-EMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVH--EKIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI 195          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: UCPA_SALTY (Oxidoreductase ucpA OS=Salmonella typhimurium GN=ucpA PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.378e-20
Identity = 80/248 (32.26%), Postives = 127/248 (51.21%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVAS------RTYPLRDFGTTDP-ALTSLVRYLVHDSSDMYPGTFSLL 724
            TGAS G+G       A+ G  ++      D ++ L DE+    G   R  AV+ DV  + A+++ +V  A E  GRID LVNNAGV   + + LD++EE+ +  +  N+ G W V+K V   M    ++G ++ +SS+        PG  AYA SKA +  +TK L++E     IRVN+ICPG  ++ + E + ++   ++  S      +  PLR     DP  +  L  +L  D S    GT +++
Sbjct:   12 TGASQGIGEGIARVFARHGANLILLDIS-DEIEKLADELG---GRGHRCTAVKADVR-DFASVQAAVARAKETEGRIDILVNNAGVC-RLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIK-RKDGRIVMMSSVTGDMVAD-PGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDPESVLTEMAKAIPLRRL--ADPLEVGELAAFLASDESSYLTGTQNVI 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: UCPA_SALTI (Oxidoreductase ucpA OS=Salmonella typhi GN=ucpA PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.378e-20
Identity = 80/248 (32.26%), Postives = 127/248 (51.21%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVAS------RTYPLRDFGTTDP-ALTSLVRYLVHDSSDMYPGTFSLL 724
            TGAS G+G       A+ G  ++      D ++ L DE+    G   R  AV+ DV  + A+++ +V  A E  GRID LVNNAGV   + + LD++EE+ +  +  N+ G W V+K V   M    ++G ++ +SS+        PG  AYA SKA +  +TK L++E     IRVN+ICPG  ++ + E + ++   ++  S      +  PLR     DP  +  L  +L  D S    GT +++
Sbjct:   12 TGASQGIGEGIARVFARHGANLILLDIS-DEIEKLADELG---GRGHRCTAVKADVR-DFASVQAAVARAKETEGRIDILVNNAGVC-RLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIK-RKDGRIVMMSSVTGDMVAD-PGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARQSNPDDPESVLTEMAKAIPLRRL--ADPLEVGELAAFLASDESSYLTGTQNVI 249          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_CHLMU (3-oxoacyl-[acyl-carrier-protein] reductase OS=Chlamydia muridarum GN=fabG PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.378e-20
Identity = 76/219 (34.70%), Postives = 113/219 (51.60%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNVASRTYPLRDFGTTD 649
            TG S G+G       A+ G  +       +  KS   +++ ++GS V    V  DVS N   +   VQ     +G ID +VNNAG++      + ++EEEW+ ++ TNL   + V   V IR     + G+++NISSI    RG  PG   YA++KAG+   +K LS E+G   IRVN I PG   +++T+GL   +K +WL  V     PL   GT +
Sbjct:   13 TGGSRGIGFGIAKLFAEHGANVQIWGINEEAGKSAAQDLSDKTGSKVSFALV--DVSKNDM-VSAQVQKFLAEYGTIDVVVNNAGITRD-SLLMRMSEEEWSSVIDTNLGSIYNVCSAV-IRPMIKARSGAIVNISSIVGL-RGS-PGQTNYAAAKAGIIGFSKALSKEVGSKNIRVNCIAPGFIDTDMTKGLSDNLKNEWLKGV-----PLGRVGTPE 219          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHGB_BACME (Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.378e-20
Identity = 68/190 (35.79%), Postives = 109/190 (57.37%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAAR-RVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI 568
            TG+S+GLG+   +  A    ++V   R + D   S+ +E  K+ G    A+AV+ DV+     I N VQ A + FG++D ++NNAG+   V S  +++  +WN ++ TNLTG++L S+       + + +G+VIN+SS+    +   P  V YA+SK G+  MT+ L+LE     IRVN+I PG   + I
Sbjct:   13 TGSSTGLGKSMAIRFATEKAKVVVNYRSKEDEANSVLEEEIKKVGGE--AIAVKGDVTVESDVI-NLVQSAIKEFGKLDVMINNAGMENPVSSH-EMSLSDWNKVIDTNLTGAFLGSREAIKYFVENDIKGTVINMSSVHEW-KIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAINTPI 197          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_CAEEL (Probable L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=2 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.378e-20
Identity = 78/244 (31.97%), Postives = 127/244 (52.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVEL--DVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEI-----TEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGAS G+G+E CL LAKAG +++A AR    L SL  E      +S+R   + +  DVSAN   +   +   +   G    LVNNAG++    +   +T++  +     N+ G  L+++ V     D   +GS++NISS AA     L     Y +SKA L+ +T+CL+ ELG   IRVNS+ P +  +++     ++   KK  L+ +     P++ F   D  + + V +L+ D++ M  G+
Sbjct:   15 TGASQGIGKEICLSLAKAGAQVIAFARNEANLLSLVKET-----TSLRYTIIPIVGDVSANEEVLFKLIVPHFPIHG----LVNNAGIA-TNHAIGQITQQSIDRTFAVNVRGPILIAQLVARNFVDRQIKGSIVNISSQAAIR--PLDNHTVYCASKAALDMVTRCLANELGSQNIRVNSVNPTVVMTDMGRDNWSDPDKKKKMLDRM-----PIKRFAEVDEVVNA-VLFLLSDNASMTTGS 240          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
FABG_BACSU8.631e-2332.493-oxoacyl-[acyl-carrier-protein] reductase OS=Baci... [more]
DHG_BACME9.543e-2236.32Glucose 1-dehydrogenase OS=Bacillus megaterium PE=... [more]
FABG_STAES8.079e-2130.803-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
FABG_STAEQ8.079e-2130.803-oxoacyl-[acyl-carrier-protein] reductase OS=Stap... [more]
DHG1_BACME8.079e-2135.26Glucose 1-dehydrogenase 1 OS=Bacillus megaterium G... [more]
UCPA_SALTY1.378e-2032.26Oxidoreductase ucpA OS=Salmonella typhimurium GN=u... [more]
UCPA_SALTI1.378e-2032.26Oxidoreductase ucpA OS=Salmonella typhi GN=ucpA PE... [more]
FABG_CHLMU1.378e-2034.703-oxoacyl-[acyl-carrier-protein] reductase OS=Chla... [more]
DHGB_BACME1.378e-2035.79Glucose 1-dehydrogenase B OS=Bacillus megaterium G... [more]
DCXR_CAEEL1.378e-2031.97Probable L-xylulose reductase OS=Caenorhabditis el... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top