EY659227

Overview
NameEY659227
Unique NameEY659227
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length495
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659227_ssr454 microsatellite EY659227_ssr454:454..465. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7467 contig Csv1_Contig7467:1..495. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659227 vs. ExPASy Swiss-Prot
Match: PHOT1_ARATH (Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.834e-19
Identity = 40/64 (62.50%), Postives = 50/64 (78.12%), Query Frame = 1
Query:    1 RDPXSRLGSHEGANEIKKHPFFKGVNWALVRCMNPPELDAPLFATDTEKEYKVVDPGMQDLQQN 192
            RDP  RLG  EGANE+K+H FFKG+NWAL+RC NPPEL+ P+F+ + E   KVVDP ++DLQ N
Sbjct:  931 RDPKKRLGCFEGANEVKQHSFFKGINWALIRCTNPPELETPIFSGEAENGEKVVDPELEDLQTN 994          
BLAST of EY659227 vs. ExPASy Swiss-Prot
Match: PHOT2_ARATH (Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 6.319e-12
Identity = 34/61 (55.74%), Postives = 43/61 (70.49%), Query Frame = 1
Query:    1 RDPXSRLGSHEGANEIKKHPFFKGVNWALVRCMNPPELDAPLFATDTE---KEYKVVDPGM 174
            RDP SRLGS  GANEIK+H FF+G+NW L+R M+PP LDAPL   + +   K+ K  D G+
Sbjct:  843 RDPSSRLGSKGGANEIKQHAFFRGINWPLIRGMSPPPLDAPLSIIEKDPNAKDIKWEDDGV 903          
The following BLAST results are available for this feature:
BLAST of EY659227 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PHOT1_ARATH1.834e-1962.50Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=... [more]
PHOT2_ARATH6.319e-1255.74Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659227 ID=EY659227|Name=EY659227|organism=Citrus sinensis|type=EST|length=495bp
AGAGATCCAAANAGCAGATTAGGTTCGCATGAAGGAGCAAATGAAATAAA
GAAGCATCCATTTTTCAAAGGTGTCAATTGGGCACTAGTTCGTTGCATGA
ACCCTCCTGAGCTGGATGCCCCTCTCTTCGCTACCGATACTGAGAAGGAG
TATAAAGTTGTGGATCCAGGAATGCAAGATCTGCAACAAAACGTTTTCTG
AGGAGTCTAATTCTTTGTTATTTTATTTGAAGTGTCTGCTGCAAATTTGT
GTTGGTACGTGCATCCCATTTAGTAGAGGCTATGGAAGGGGAGCTCAACT
TGACGAGTAATAACAGTTTCATTGATTCTGCTTGTGCTTTCACCTCGGCA
GTTGTCGTCGATAGATAATCTTGGAGGCCTTGTGTATGTAATATATTACT
TGTATGCATCGTTTGTATCTGTTTTGCTGGGTACTTTGTAAGTTTTGTAT
TTTATTAATTAATTAGTTAATTAATCCAAAAAAAAAAAAAAAAAA
back to top