EY659224

Overview
NameEY659224
Unique NameEY659224
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length943
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659224 vs. ExPASy Swiss-Prot
Match: KPYA_RICCO (Pyruvate kinase isozyme A, chloroplastic OS=Ricinus communis PE=1 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 1.800e-71
Identity = 132/149 (88.59%), Postives = 144/149 (96.64%), Query Frame = 3
Query:   39 ALTVLRSVSLRIQKWWREEKRHEAMELPDVGSSFAESISEEICNSAAKMANNLEVDALFVYTKTGHMASLLSRCRPDCPIFAFTSTTSVRRRLNLRWGLIPFRLSFSDDMESNLNRTFSLLKARGMIKSGDLVIAVSDVLQSIQVMNVP 485
            AL VLRSVS+RI+KWWREEK HEAMELP +GS++++SISEEICNSAAKMANNL VDALFVYTK GHMASLLSRCRPDCPIFAFT+TTSVRRRLNL+WGLIPFRLSF+DDMESNLN+TFSLLKARGMIKSGDLVIAVSD+LQSIQVMNVP
Sbjct:  435 ALAVLRSVSVRIEKWWREEKHHEAMELPAIGSTYSDSISEEICNSAAKMANNLGVDALFVYTKDGHMASLLSRCRPDCPIFAFTTTTSVRRRLNLQWGLIPFRLSFADDMESNLNKTFSLLKARGMIKSGDLVIAVSDMLQSIQVMNVP 583          
BLAST of EY659224 vs. ExPASy Swiss-Prot
Match: KPYA_TOBAC (Pyruvate kinase isozyme A, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 5.236e-71
Identity = 131/149 (87.92%), Postives = 144/149 (96.64%), Query Frame = 3
Query:   39 ALTVLRSVSLRIQKWWREEKRHEAMELPDVGSSFAESISEEICNSAAKMANNLEVDALFVYTKTGHMASLLSRCRPDCPIFAFTSTTSVRRRLNLRWGLIPFRLSFSDDMESNLNRTFSLLKARGMIKSGDLVIAVSDVLQSIQVMNVP 485
            ALTVLRSVSLRI++ WRE+KRHE +ELP + SSF++SISEEICNSAAKMANNLEVDALFVYTK GHMASLLSRCRPDCPIFAFT+TTSVRRRLNL+WGL+PFRLSFSDDMESNLN+TFSLLKARGMIKSGDL+IAVSD+LQSIQVMNVP
Sbjct:  445 ALTVLRSVSLRIERMWREQKRHEVIELPSIASSFSDSISEEICNSAAKMANNLEVDALFVYTKNGHMASLLSRCRPDCPIFAFTTTTSVRRRLNLQWGLMPFRLSFSDDMESNLNKTFSLLKARGMIKSGDLIIAVSDMLQSIQVMNVP 593          
BLAST of EY659224 vs. ExPASy Swiss-Prot
Match: KPYG_TOBAC (Pyruvate kinase isozyme G, chloroplastic OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.236e-13
Identity = 45/143 (31.47%), Postives = 72/143 (50.35%), Query Frame = 3
Query:   39 ALTVLRSVSLRIQKWWREEKRHEAMELPDVGSSFAESISEEICNSAAKMANNLEVDALFVYTKTGHMASLLSRCRPDCPIFAFTSTTSVRRRLNLRWGLIPFRLSFSDDMESNLNRTFSLLKARGMIKSGDLVIAVSDVLQSI 467
            A+ V+  V+LR      E    ++   P   +++   + E     ++ MAN L    + V+T+TG MA +LS  RP   +FAFT+   V++RL L  G++P  + FS D E   +R   LL ++ ++K G  V  V    Q I
Sbjct:  410 AVKVMHIVALRT-----ESSLQKSTSSPSQSAAYKSHMGEMFAFHSSSMANTLSTP-IIVFTRTGSMAIILSHNRPSSTVFAFTNNERVKQRLALYHGVVPIYMEFSSDAEETFSRAIKLLLSKSLVKDGQYVTLVQSGAQPI 546          
BLAST of EY659224 vs. ExPASy Swiss-Prot
Match: KPYG_RICCO (Pyruvate kinase isozyme G, chloroplastic (Fragment) OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.602e-11
Identity = 46/143 (32.17%), Postives = 70/143 (48.95%), Query Frame = 3
Query:   39 ALTVLRSVSLRIQKWWREEKRHEAMELPDVGSSFAESISEEICNSAAKMANNLEVDALFVYTKTGHMASLLSRCRPDCPIFAFTSTTSVRRRLNLRWGLIPFRLSFSDDMESNLNRTFSLLKARGMIKSGDLVIAVSDVLQSI 467
            A+ V+ +V+LR       E        P    ++   + E     A  MAN L    + V+T+TG MA LLS  +P   IFAFT+   +++RL+L  G++P  + FS D E   +R   LL  +G++  G+ V  V    Q I
Sbjct:  267 AVRVMHTVALRT------ESSSPVNTTPPAQGAYKGHMGEMFAFHATIMANTLNTP-IIVFTRTGSMAVLLSHYQPASTIFAFTNEERIKQRLSLYRGVMPIYMEFSSDAEETFSRALQLLLNKGLLVEGEHVTLVQSGAQPI 402          
The following BLAST results are available for this feature:
BLAST of EY659224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
KPYA_RICCO1.800e-7188.59Pyruvate kinase isozyme A, chloroplastic OS=Ricinu... [more]
KPYA_TOBAC5.236e-7187.92Pyruvate kinase isozyme A, chloroplastic OS=Nicoti... [more]
KPYG_TOBAC2.236e-1331.47Pyruvate kinase isozyme G, chloroplastic OS=Nicoti... [more]
KPYG_RICCO1.602e-1132.17Pyruvate kinase isozyme G, chloroplastic (Fragment... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659224 ID=EY659224|Name=EY659224|organism=Citrus sinensis|type=EST|length=943bp
GCCCTCGGTCCGGNATTCAAAGGCCGACCCACGCGTCCGCATTGACTGTG
CTCAGGAGTGTCAGTCTCAGAATTCAGAAATGGTGGAGGGAAGAGAAGCG
CCATGAAGCTATGGAACTCCCAGATGTAGGATCTTCTTTTGCAGAGAGTA
TTTCGGAAGAGATTTGTAATTCTGCTGCCAAGATGGCAAATAATCTAGAG
GTGGATGCACTTTTTGTATATACAAAGACTGGCCACATGGCGTCTCTCTT
GTCTAGATGCCGACCTGACTGCCCAATCTTTGCCTTCACTAGTACAACAT
CTGTGCGAAGACGTCTGAATCTACGGTGGGGTCTGATACCATTCCGCTTG
AGCTTCTCTGATGATATGGAAAGCAACCTTAATAGAACATTCTCATTGCT
CAAGGCCAGGGGAATGATCAAATCAGGTGATCTTGTCATTGCTGTTTCAG
ACGTGTTGCAGTCAATCCAAGTCATGAACGTTCCTTGAAATCTTAGTGAG
ATCAAGATTGTTGTTTCAGCACTTCCCCAATAGCTTGTGCAATATTGTTC
CTTATACTANAAAGAGATTGTTTCTTCGAAGCAAACAGCAGGTAGTCATG
AATTCGATCTTGTTTTGAATGTTTACTGCAGAATGTTTGAGACTGCAACT
GATTTTACTTTGACANTGAGCGAGCAGTCAGGGGCAGCTCATTTCATTTG
AGCCTCTCTGGGTTTAACTGCTGGTGATCAGATTGTATTTTGGTTAGCTT
ANCCGCAGAATTTACTTTATAGGCAGAGCTGAGATTTCCCTTCTCACTCT
ATAATCTGGGAACGGGATCGCGGACTGGGGTGNATTTTGCTAATCAATCA
GCTCAGTTTCCTGGTCTTNNAAAAAAAANNNNNAAAAANNANNANAAAAA
AAAAAAAAAAAAAAGGGCGGCGGTTTTAAGATCAAGTTACTAC
back to top