EY659223

Overview
NameEY659223
Unique NameEY659223
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length938
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659223_ssr602 microsatellite EY659223_ssr602:602..613. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig9450 contig Csv1_Contig9450:358..1295. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP13_ARATH (Ubiquitin carboxyl-terminal hydrolase 13 OS=Arabidopsis thaliana GN=UBP13 PE=1 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 8.037e-72
Identity = 124/147 (84.35%), Postives = 136/147 (92.52%), Query Frame = 2
Query:    5 LNDQYWTLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQYLGLEHSDNAPKRAYSVNQNRHTYEKPVKIYN 445
            +NDQYWTLRAEEIPEEEKN+GPNDRLIHVYHFTKE+ QNQ QVQNFGEPFFLVIHEGETL E+K RIQ+KL VPDE+F+KWKFA  S+GRP+YL+DTD V+NRFQRRDVYGAWEQYLGLEH DNAPKRAY+ NQNRH YEKPVKIYN
Sbjct:  970 INDQYWTLRAEEIPEEEKNIGPNDRLIHVYHFTKEAGQNQ-QVQNFGEPFFLVIHEGETLEEIKTRIQKKLHVPDEDFAKWKFASFSMGRPDYLLDTDVVYNRFQRRDVYGAWEQYLGLEHIDNAPKRAYAANQNRHAYEKPVKIYN 1115          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP12_ARATH (Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabidopsis thaliana GN=UBP12 PE=2 SV=2)

HSP 1 Score: 259.225 bits (661), Expect = 2.420e-68
Identity = 120/147 (81.63%), Postives = 133/147 (90.48%), Query Frame = 2
Query:    5 LNDQYWTLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQYLGLEHSDNAPKRAYSVNQNRHTYEKPVKIYN 445
            +NDQYWTLRAEEIPEEEKN+GPNDRLI VYHF KE+ QNQ QVQNFGEPFFLVIHEGETL E+K RIQ+KL V DE+F+KWKFAF+S+GRPEYL DTD V+NRFQRRDVYGA+EQYLGLEH+D  PKRAY+ NQNRH YEKPVKIYN
Sbjct:  971 INDQYWTLRAEEIPEEEKNIGPNDRLILVYHFAKETGQNQ-QVQNFGEPFFLVIHEGETLEEIKNRIQKKLHVSDEDFAKWKFAFMSMGRPEYLQDTDVVYNRFQRRDVYGAFEQYLGLEHADTTPKRAYAANQNRHAYEKPVKIYN 1116          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP7_RAT (Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus GN=Usp7 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 8.169e-16
Identity = 57/146 (39.04%), Postives = 80/146 (54.79%), Query Frame = 2
Query:   23 TLRAEEIPEEEKNLGP-NDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQ---YLGLEHSDNAPKRAYSVNQNRHTY-EKPVKIYN 445
            T R EEIP ++ N+   N+ LI V HF KE          FG PF L IH+GE   EV +RIQ  L + ++EF K+KFA + +GR +Y+ + +   N        G       +LGL+H + APKR      +R+TY EK +KI+N
Sbjct:  970 TFRIEEIPLDQVNIDKENEMLITVAHFHKEV------FGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR------SRYTYLEKAIKIHN 1103          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP7_MOUSE (Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus GN=Usp7 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 3.104e-15
Identity = 56/146 (38.36%), Postives = 80/146 (54.79%), Query Frame = 2
Query:   23 TLRAEEIPEEEKNLGP-NDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQ---YLGLEHSDNAPKRAYSVNQNRHTY-EKPVKIYN 445
            T R EEIP ++ ++   N+ LI V HF KE          FG PF L IH+GE   EV +RIQ  L + ++EF K+KFA + +GR +Y+ + +   N        G       +LGL+H + APKR      +R+TY EK +KI+N
Sbjct:  970 TFRIEEIPLDQVDIDKENEMLITVAHFHKEV------FGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR------SRYTYLEKAIKIHN 1103          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP7_HUMAN (Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens GN=USP7 PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 4.054e-15
Identity = 55/146 (37.67%), Postives = 80/146 (54.79%), Query Frame = 2
Query:   23 TLRAEEIPEEEKNLGP-NDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQ---YLGLEHSDNAPKRAYSVNQNRHTY-EKPVKIYN 445
            T R EEIP ++ ++   N+ L+ V HF KE          FG PF L IH+GE   EV +RIQ  L + ++EF K+KFA + +GR +Y+ + +   N        G       +LGL+H + APKR      +R+TY EK +KI+N
Sbjct:  969 TFRIEEIPLDQVDIDKENEMLVTVAHFHKEV------FGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR------SRYTYLEKAIKIHN 1102          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP7_DROME (Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster GN=Usp7 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.432e-14
Identity = 52/145 (35.86%), Postives = 77/145 (53.10%), Query Frame = 2
Query:   23 TLRAEEIPEEEKNLGPNDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQ----YLGLEHSDNAPKRAYSVNQNRHTYEKPVKIYN 445
            T R EE+P E+  L  N+ LI V HF+KE         +FG PF     +GE    +K+RIQR+L V D+E+  +KF  +S+G      + D   N     +VY +W      + GL+H + + KR+ S+N +    EK +KIYN
Sbjct: 1001 TFRIEEVPAEDMQLAENEFLIPVAHFSKEL------YNSFGIPFLTKARQGEPYGALKQRIQRRLNVQDKEWENYKFCVISMGH-----NADVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRS-SLNFS----EKAIKIYN 1129          
BLAST of EY659223 vs. ExPASy Swiss-Prot
Match: UBP7_CHICK (Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus gallus GN=USP7 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 6.472e-13
Identity = 55/146 (37.67%), Postives = 75/146 (51.37%), Query Frame = 2
Query:   23 TLRAEEIPEEEKNLGP-NDRLIHVYHFTKESAQNQMQVQNFGEPFFLVIHEGETLAEVKERIQRKLQVPDEEFSKWKFAFLSLGRPEYLVDTDTVFNRFQRRDVYGAWEQ---YLGLEHSDNAPKRAYSVNQNRHTY-EKPVKIYN 445
            T R EEIP  + ++   N+ LI V HF KE          FG PF L IH+G    EV +RIQ  L + ++EF K+KFA + +GR  YL + +   N        G       +LGL+H + APK       +R+TY EK  KI+N
Sbjct:  969 TFRIEEIPLAQVDIDKENEMLITVAHFHKEV------FGTFGIPFLLRIHQGGHFREVMKRIQTMLDIQEKEFEKFKFAIVMMGRHTYLNEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPK-------DRYTYLEKAYKIHN 1101          
The following BLAST results are available for this feature:
BLAST of EY659223 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
UBP13_ARATH8.037e-7284.35Ubiquitin carboxyl-terminal hydrolase 13 OS=Arabid... [more]
UBP12_ARATH2.420e-6881.63Ubiquitin carboxyl-terminal hydrolase 12 OS=Arabid... [more]
UBP7_RAT8.169e-1639.04Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus ... [more]
UBP7_MOUSE3.104e-1538.36Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus mus... [more]
UBP7_HUMAN4.054e-1537.67Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sa... [more]
UBP7_DROME3.432e-1435.86Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosoph... [more]
UBP7_CHICK6.472e-1337.67Ubiquitin carboxyl-terminal hydrolase 7 OS=Gallus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G05-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659223 ID=EY659223|Name=EY659223|organism=Citrus sinensis|type=EST|length=938bp
AGAATTAAATGATCAATACTGGACCCTTCGTGCAGAGGAGATCCCGGAGG
AAGAGAAGAACCTTGGTCCCAACGATCGCTTGATTCATGTTTACCACTTT
ACGAAAGAGTCTGCACAGAATCAAATGCAAGTACAAAATTTTGGGGAACC
ATTTTTCTTGGTTATCCATGAAGGTGAAACATTAGCCGAAGTTAAAGAGC
GCATACAAAGGAAATTGCAAGTTCCTGATGAGGAGTTCTCTAAGTGGAAG
TTTGCTTTCTTATCACTGGGTCGTCCAGAGTACCTTGTGGATACTGACAC
TGTTTTCAACCGTTTTCAGAGACGAGACGTTTATGGTGCTTGGGAACAGT
ACCTTGGGTTGGAGCATTCTGATAATGCTCCCAAGAGAGCTTATTCCGTA
AATCAGAACCGGCACACATATGAGAAGCCCGTCAAAATATACAACTAATG
CAAGAGCCTATGATCCACCTACACATAAGCTGAGAAGAAAAACCTTCAAT
GCCTTGATGTAATTATGTAATTGGGCAGGATTGACAATGAACAAATGATG
GATTTGAATGTACAAACAAGGCTCGCCTTGAGATGTTTCTGTGGGGCTCC
ATTGTTTGTTTGTGGGCTATATCTGTTTCTTTGATTGATGTGGGTGGGCA
AGCAGAGATTTTAGTAGTGTGGTCTGTCATTGTCAACACAACCTGCATGA
GCAATCTCTTTTGTTTTTTCCCTGGCTTTAAGAAGACACCTTGCCTNNCA
GCTTTGAGAGGCTGGTGGNTTTTATGTATACAGCTCCCAGTGTATTTANC
AAGCAGTATATAAAAAGATTTTGACGGGGATGTATACTGGGTATAGNTNG
NTGCAACTGAAACTAANTNCTNCTTTTTTTTCCTTTTGACCCTTGTCCTC
TTTCTGAGTGAATTGGGATCTTCAGATGAGCTTGAAAA
back to top