EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: RUBB_PEA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 488.419 bits (1256), Expect = 2.236e-137
Identity = 257/288 (89.24%), Postives = 271/288 (94.10%), Query Frame = 3
Query:    6 LHFNKXGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLGL-RAAEQYLETL 866
            LHFNK G A+KKLQNGVNKLADLVGVTLGPKGRNVVLESKYG+PKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALV+ELK+MSKEVEDSELADVAAVSAGNN+EVGNMIAEA+SKVGRKGVVTLEEGKSAEN LYVVEGMQFDRGYISPYFVTDSEKM VE+ENCKLLLVDKKITNARDLIN+LEDAIR  +PI+IIAEDIEQEAL TLVVNKLRG+L+ AALK  G      QYL+ +
Sbjct:   53 LHFNKDGSAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVAELKKMSKEVEDSELADVAAVSAGNNHEVGNMIAEALSKVGRKGVVTLEEGKSAENSLYVVEGMQFDRGYISPYFVTDSEKMTVEFENCKLLLVDKKITNARDLINILEDAIRSGFPIVIIAEDIEQEALATLVVNKLRGSLKIAALKAPGFGERKSQYLDDI 340          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: RUBB_ARATH (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Arabidopsis thaliana GN=At1g55490 PE=1 SV=3)

HSP 1 Score: 475.322 bits (1222), Expect = 1.958e-133
Identity = 249/288 (86.46%), Postives = 267/288 (92.71%), Query Frame = 3
Query:    6 LHFNKXGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLGL-RAAEQYLETL 866
            LHFNK G  +++LQ GVNKLADLVGVTLGPKGRNVVLESKYG+P+IVNDGVTVA+EVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQG IAEGVKVVAAGANPVLITRGIEKT+KALV+ELK+MSKEVEDSELADVAAVSAGNN E+GNMIAEAMSKVGRKGVVTLEEGKSAEN LYVVEGMQFDRGYISPYFVTDSEKM+VE++NCKLLLVDKKITNARDL+ VLEDAIRG YPILIIAEDIEQEAL TLVVNKLRG L+ AAL+  G      QYL+ +
Sbjct:   59 LHFNKDGTTIRRLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAKALVTELKKMSKEVEDSELADVAAVSAGNNDEIGNMIAEAMSKVGRKGVVTLEEGKSAENNLYVVEGMQFDRGYISPYFVTDSEKMSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGTLKIAALRAPGFGERKSQYLDDI 346          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: RUBB_BRANA (RuBisCO large subunit-binding protein subunit beta, chloroplastic OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 2.558e-133
Identity = 248/288 (86.11%), Postives = 267/288 (92.71%), Query Frame = 3
Query:    6 LHFNKXGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLGL-RAAEQYLETL 866
            LHFNK G  ++KLQ GVNKLADLVGVTLGPKGRNVVLESKYG+P+IVNDGVTVA+EVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQG IAEGVKVVAAGANPVLITRGIEKT+KALV+ELK+MSKEVEDSELADVAAVSAGNN E+G+MIAEAMS+VGRKGVVTLEEGKSAEN LYVVEGMQFDRGY+SPYFVTDSEKM+VE++NCKLLLVDKKITNARDL+ VLEDAIRG YPILIIAEDIEQEAL TLVVNKLRG L+ AALK  G      QYL+ +
Sbjct:   59 LHFNKDGTTIRKLQAGVNKLADLVGVTLGPKGRNVVLESKYGSPRIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGFIAEGVKVVAAGANPVLITRGIEKTAKALVAELKKMSKEVEDSELADVAAVSAGNNAEIGSMIAEAMSRVGRKGVVTLEEGKSAENALYVVEGMQFDRGYVSPYFVTDSEKMSVEFDNCKLLLVDKKITNARDLVGVLEDAIRGGYPILIIAEDIEQEALATLVVNKLRGTLKIAALKAPGFGERKSQYLDDI 346          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: RUBB_SECCE (RuBisCO large subunit-binding protein subunit beta, chloroplastic (Fragment) OS=Secale cereale GN=CPN60 PE=2 SV=1)

HSP 1 Score: 403.29 bits (1035), Expect = 9.458e-112
Identity = 212/245 (86.53%), Postives = 227/245 (92.65%), Query Frame = 3
Query:  135 PKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLGL-RAAEQYLETL 866
            P+IVNDGVTVA+EVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKV+AAGANPV ITRGIEKT+KALV ELK+MSKEVEDSELADVAAVSAGNNYE+GNMIAEAMSKVGRKGVVTLEEG+S+EN LYVVEGMQF+RGYISPYFVTDSEKM  EYENCKLLLVDKKITNARDLINVLE+AIRG YPILIIAEDIEQEAL TLVVNKLRG+L+  A+K  G      QYL+ +
Sbjct:    1 PQIVNDGVTVAREVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVIAAGANPVQITRGIEKTAKALVLELKKMSKEVEDSELADVAAVSAGNNYEIGNMIAEAMSKVGRKGVVTLEEGRSSENNLYVVEGMQFERGYISPYFVTDSEKMTTEYENCKLLLVDKKITNARDLINVLEEAIRGQYPILIIAEDIEQEALATLVVNKLRGSLKICAIKAPGFGERKTQYLDDI 245          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_ACAM1 (60 kDa chaperonin 1 OS=Acaryochloris marina (strain MBIC 11017) GN=groL1 PE=3 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 5.396e-91
Identity = 168/272 (61.76%), Postives = 210/272 (77.21%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLGLRAAEQ 851
            + L+ GVN LAD V +TLGPKGRNVVLE K+GAP+I+NDGVT+AKEVELEDP+EN GA+L+R+ A+KTND+AGDGTTT+ VLAQ LI EG+K VAAGANPV + +GI+KT  ALV E++  SK V    +A VA +SAGN+ EVG MIA+AM KVG+ GV+T+EE KS    + +VEGMQ DRGYISPYFVTD+E+M  E EN +LL+V+KKI++ +DL+ +LE   R   P+LIIAED+E EAL TLVVNKLRG L   A+K  G     Q
Sbjct:   13 RALERGVNSLADAVRITLGPKGRNVVLEKKFGAPQIINDGVTIAKEVELEDPLENAGAQLMREVASKTNDVAGDGTTTATVLAQALIREGLKNVAAGANPVALRKGIDKTIDALVKEIEAKSKPVAGDAIAQVATISAGNDTEVGQMIAQAMDKVGKDGVITVEESKSLATEMEIVEGMQIDRGYISPYFVTDAERMVAEIENARLLIVNKKISSLQDLVGILEQVARAGQPLLIIAEDLEGEALATLVVNKLRGVLNVVAIKAPGFGERRQ 284          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNJA (60 kDa chaperonin 1 OS=Synechococcus sp. (strain JA-3-3Ab) GN=groL1 PE=3 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.469e-88
Identity = 163/266 (61.28%), Postives = 206/266 (77.44%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            A K L+ G+N+LAD V VT+GPKGRNV+LE K+GAP+IVNDGVT+AKE+EL DP+EN GA+L+R+ A KTND+AGDGTTT+ +LAQ ++ EG+K ++AGANPV + RGIEKT+  LV ++   +K VE    +A+VA +SAGN+ EVG MIA AM  VGR GV+T+EE KS E  L VVEGMQFDRGYISPYFVTD+E+M  EYEN  LL+   K++N +DL+ VLE   R   P+L+IAED+E EAL TLVVNKLRG L   A+K
Sbjct:   11 ARKALEQGINQLADAVKVTIGPKGRNVLLEKKFGAPQIVNDGVTIAKEIELADPLENTGAQLMREVATKTNDVAGDGTTTATILAQSMVQEGLKNISAGANPVALRRGIEKTTAYLVEQIAAQAKPVEGRKNIAEVATISAGNDPEVGEMIARAMDAVGRDGVITVEESKSLETQLEVVEGMQFDRGYISPYFVTDTERMVAEYENAYLLITSNKLSNLQDLVPVLERVAREGRPLLVIAEDVEGEALATLVVNKLRGVLNAVAVK 276          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_GLOVI (60 kDa chaperonin 2 OS=Gloeobacter violaceus GN=groL2 PE=3 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 3.273e-88
Identity = 167/269 (62.08%), Postives = 212/269 (78.81%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVN LAD V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELEDP+EN GA+L+R+ A+KTND+AGDGTTT+ VLAQ LI EG++ VAAGANP+ + RG+EKT   LV E+  M+K VED++ +A+VA +S+GN+ E+G MIAEAM KVG++GV+T+EE KS    L VVEGMQFD+GY+SPYFVTD+E+M  + +   +LL DKKI+  +DLI VLE   R   P+LII+ED+E EAL TLVVNKLRG L   A+K  G
Sbjct:   11 ARRALERGVNALADAVRVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDPLENTGAQLIREVASKTNDVAGDGTTTATVLAQALIREGLRNVAAGANPMSLKRGMEKTVAKLVQEIAAMAKPVEDNKTIAEVATISSGNDEEIGQMIAEAMDKVGKEGVITVEESKSLVTELDVVEGMQFDKGYVSPYFVTDTERMITDLDEPFILLTDKKISIIQDLIPVLEKVARAGRPLLIISEDLEGEALATLVVNKLRGVLNCVAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_THEVL (60 kDa chaperonin 2 OS=Thermosynechococcus vulcanus GN=groL2 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 4.275e-88
Identity = 164/263 (62.36%), Postives = 203/263 (77.19%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            + L+ G+N LAD V +TLGPKGRNVVLE KYGAP+IVNDGVT+AKE+ELED  EN GA+L+R+ AAKTND+ GDGTTT+ VLAQ LI EG+K VAAG NP+ + RG+EK  K +V  + +++K VE   +A VA VSAGN+ EVG MI+EAM+KVG+ GV+T+EE KS +  + +VEGMQFDRGYISPYFVTD E+M V+  N  LLL DKKIT+ +DLI  LE   R   P++IIAED+E EAL TLVVNKLRG L   A+K
Sbjct:   13 RSLERGINALADAVKITLGPKGRNVVLEKKYGAPQIVNDGVTIAKEIELEDAYENTGAQLMREVAAKTNDVVGDGTTTATVLAQALIREGLKNVAAGTNPIALKRGMEKAIKTIVDGIAEVAKPVEGDMIAQVATVSAGNDPEVGAMISEAMAKVGKDGVITIEESKSLQTEMEIVEGMQFDRGYISPYFVTDPERMIVQLNNAYLLLTDKKITSIQDLIPTLERVARSGRPLVIIAEDVEGEALATLVVNKLRGVLNVVAVK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_THEEB (60 kDa chaperonin 2 OS=Thermosynechococcus elongatus (strain BP-1) GN=groL2 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 4.275e-88
Identity = 164/263 (62.36%), Postives = 203/263 (77.19%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            + L+ G+N LAD V +TLGPKGRNVVLE KYGAP+IVNDGVT+AKE+ELED  EN GA+L+R+ AAKTND+ GDGTTT+ VLAQ LI EG+K VAAG NP+ + RG+EK  K +V  + +++K VE   +A VA VSAGN+ EVG MI+EAM+KVG+ GV+T+EE KS +  + +VEGMQFDRGYISPYFVTD E+M V+  N  LLL DKKIT+ +DLI  LE   R   P++IIAED+E EAL TLVVNKLRG L   A+K
Sbjct:   13 RSLERGINALADAVKITLGPKGRNVVLEKKYGAPQIVNDGVTIAKEIELEDAYENTGAQLMREVAAKTNDVVGDGTTTATVLAQALIREGLKNVAAGTNPIALKRGMEKAIKTIVDGIAEVAKPVEGDMIAQVATVSAGNDPEVGAMISEAMAKVGKDGVITIEESKSLQTEMEIVEGMQFDRGYISPYFVTDPERMIVQLNNAYLLLTDKKITSIQDLIPTLERVARSGRPLVIIAEDVEGEALATLVVNKLRGVLNVVAVK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNJB (60 kDa chaperonin 2 OS=Synechococcus sp. GN=groL2 PE=3 SV=1)

HSP 1 Score: 324.709 bits (831), Expect = 4.275e-88
Identity = 162/266 (60.90%), Postives = 209/266 (78.57%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            A K L+ G+N+LAD + VT+GPKGRNVVLE K+GAP+IVNDGVT+AKE+EL DP+EN GA+L+R+ A+KTND+AGDGTTT+ +LAQ ++ EG+K ++AGANPV + RGIEKT+  LV ++   +K VE  + +A+VA +SAGN+ EVG MIA+AM  VGR GV+T+EE KS E  L VVEGMQFDRGYISPYFVTDSE+M  EYEN  LL+   KI++ +DL+ +LE   R   P+L+IAED+E EAL TLVVN+LRG L   A+K
Sbjct:   11 ARKALEQGINQLADAIKVTIGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELADPLENTGAQLMREVASKTNDVAGDGTTTATILAQSMVREGLKNISAGANPVALRRGIEKTTAYLVEQIAAHAKPVEGRKTIAEVATISAGNDSEVGEMIAKAMDAVGRDGVITVEESKSLETELDVVEGMQFDRGYISPYFVTDSERMVAEYENAYLLITSNKISSLQDLVPILERVAREGRPLLVIAEDVEGEALATLVVNRLRGVLNAVAVK 276          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RUBB_PEA2.236e-13789.24RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_ARATH1.958e-13386.46RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_BRANA2.558e-13386.11RuBisCO large subunit-binding protein subunit beta... [more]
RUBB_SECCE9.458e-11286.53RuBisCO large subunit-binding protein subunit beta... [more]
CH601_ACAM15.396e-9161.7660 kDa chaperonin 1 OS=Acaryochloris marina (strai... [more]
CH601_SYNJA1.469e-8861.2860 kDa chaperonin 1 OS=Synechococcus sp. (strain J... [more]
CH602_GLOVI3.273e-8862.0860 kDa chaperonin 2 OS=Gloeobacter violaceus GN=gr... [more]
CH602_THEVL4.275e-8862.3660 kDa chaperonin 2 OS=Thermosynechococcus vulcanu... [more]
CH602_THEEB4.275e-8862.3660 kDa chaperonin 2 OS=Thermosynechococcus elongat... [more]
CH602_SYNJB4.275e-8860.9060 kDa chaperonin 2 OS=Synechococcus sp. GN=groL2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top