EY659216

Overview
NameEY659216
Unique NameEY659216
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length713
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10018 contig Csv1_Contig10018:729..1443. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RR1_SPIOL (30S ribosomal protein S1, chloroplastic OS=Spinacia oleracea GN=RPS1 PE=1 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.644e-86
Identity = 163/174 (93.68%), Postives = 170/174 (97.70%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQAQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTLNSDGILGPLSPDLPADGLDLTDISPA 570
            EVDEEQSRLV+SNRKAMADSQAQLGIGSVV GTVQSLKPYGAFIDIGGINGLLHVSQISHDRV+DIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTL+SDGILGPL+ DLPA+GLDL+ + PA
Sbjct:  235 EVDEEQSRLVMSNRKAMADSQAQLGIGSVVTGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVSDIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTLSSDGILGPLTSDLPAEGLDLSVVPPA 408          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1_SYNP6 (30S ribosomal protein S1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsA PE=1 SV=4)

HSP 1 Score: 156.377 bits (394), Expect = 1.411e-37
Identity = 73/129 (56.59%), Postives = 104/129 (80.62%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQA-QLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQ 432
            EVDE+++RLVLS+R+A+ + +  +L +G VV+G V+ +KPYGAFIDIGG++GLLH+S+ISHD +    +V    D +KVMI+  D ERGR+SLSTK+LEP PGDM+RNP++V+EKAEEMA  +R+++ Q
Sbjct:  170 EVDEDRNRLVLSHRRALVERKMNRLEVGEVVVGAVRGIKPYGAFIDIGGVSGLLHISEISHDHIETPHSVFNVNDEVKVMIIDLDAERGRISLSTKQLEPEPGDMVRNPEVVYEKAEEMAAQYREKLKQ 298          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1A_SYNY3 (30S ribosomal protein S1 homolog A OS=Synechocystis sp. (strain PCC 6803) GN=rps1A PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.236e-33
Identity = 72/134 (53.73%), Postives = 103/134 (76.87%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQAQ-LGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQ-RIAQAEAM 444
            EVDEE++RLVLS+R+A+ + +   L +  VV+G+V+ +KPYGAFIDIGG++GLLH+S+ISHD +    +V    D +KVMI+  D ERGR+SLSTK+LEP PG M+++  LV E A+EMA+ FRQ R+A+A+ +
Sbjct:  169 EVDEERNRLVLSHRRALVERKMNGLEVAQVVVGSVRGIKPYGAFIDIGGVSGLLHISEISHDHIDTPHSVFNVNDEIKVMIIDLDAERGRISLSTKQLEPEPGAMLKDRDLVNEMADEMAEIFRQKRLAEAQGI 302          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1_LEULA (40S ribosomal protein S1 OS=Leuconostoc lactis GN=rps1 PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 2.956e-19
Identity = 53/112 (47.32%), Postives = 74/112 (66.07%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQ---------AQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGD 357
            E+D   +RL+LS RKA+A  +         ++L +G VV GTV  L  +GAF+D+GG++GL+HVS+ISHDRV + A VL  GD + V IL+ D E+GR+SLS K  +  P D
Sbjct:  197 EIDPANARLILS-RKAVAAQELAAQLAEVFSKLSVGEVVEGTVARLTDFGAFVDLGGVDGLVHVSEISHDRVKNPADVLTKGDKVDVKILALDTEKGRISLSIKATQRGPWD 307          

HSP 2 Score: 72.0182 bits (175), Expect = 3.500e-12
Identity = 43/105 (40.95%), Postives = 65/105 (61.90%), Query Frame = 1
Query:   52 VDEEQSRLVLS----NRKAMADSQAQLGIGSVVIGTVQSLKPYGAFIDI-GGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTP 351
            +D E+ R+ LS     R    ++  Q+  GSV+ GTV+ +K +GAF++I  GI GL+HVSQIS+ R+ + + VL+ GD ++V +L       R+SLS K LE  P
Sbjct:  287 LDTEKGRISLSIKATQRGPWDEAADQIAAGSVLEGTVKRVKDFGAFVEILPGIEGLVHVSQISNKRIENPSEVLKSGDKVQVKVLDIKPAEERISLSMKALEEKP 391          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1_SYNE7 (30S ribosomal protein S1 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsA PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.269e-18
Identity = 45/127 (35.43%), Postives = 79/127 (62.20%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQA-QLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRI 426
            EV+    +LVLS R+A   +   ++ +G ++ G V  LKP+G F+D+GG   LL ++QIS   VAD+  + + GD ++ ++++ D  +GR+SLSTK LE  PG+++ N   +   A + A+  R+++
Sbjct:  166 EVNRADKKLVLSERQAARTALVREIEVGQLINGKVTGLKPFGVFVDLGGATALLPINQISQKFVADVGAIFKIGDPIQALVVAIDNTKGRISLSTKVLENHPGEILENVAELQASAADRAERARKQL 292          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1H_BACSU (30S ribosomal protein S1 homolog OS=Bacillus subtilis GN=ypfD PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.269e-18
Identity = 48/113 (42.48%), Postives = 72/113 (63.72%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQAQ--------LGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMI 363
            E+D +++R++LS+R  +   QA         L +GSV+ G VQ L  +GAF+DIGGI+GL+H+SQ+SH  V   + V++ G  +KV +LS DR+  R+SLS K   P P + I
Sbjct:  154 ELDRDKNRVILSHRAVVESEQANKKQELLQSLEVGSVLDGKVQRLTDFGAFVDIGGIDGLVHISQLSHSHVEKPSDVVEEGQEVKVKVLSVDRDNERISLSIKDTLPGPWNQI 266          

HSP 2 Score: 71.2478 bits (173), Expect = 5.970e-12
Identity = 41/105 (39.05%), Postives = 62/105 (59.05%), Query Frame = 1
Query:   52 VDEEQSRLVLSNRKAMADSQAQLGI----GSVVIGTVQSLKPYGAFIDI-GGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTP 351
            VD +  R+ LS +  +     Q+G     G V+ GTVQ L  +GAF++I  G+ GL+H+SQIS+  +     VL+ G T+KV +L  +    R+SLS ++LE TP
Sbjct:  244 VDRDNERISLSIKDTLPGPWNQIGEKVKPGDVLEGTVQRLVSFGAFVEILPGVEGLVHISQISNKHIGTPHEVLEEGQTVKVKVLDVNENEERISLSMRELEETP 348          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1H_BACC1 (30S ribosomal protein S1 homolog OS=Bacillus cereus (strain ATCC 10987) GN=BCE_1625 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.622e-17
Identity = 48/113 (42.48%), Postives = 75/113 (66.37%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMA---DSQAQLGI-----GSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMI 363
            E+D E++R++LS++  +    DS+ +  I     G VV GTVQ L  +GAF+++GG++GL+H+SQISH+RV   + VL+ G  +KV +LS D +  R+SLS K  +P P + I
Sbjct:  155 ELDREKNRVILSHKAVVELELDSKKKEAISSLKEGDVVEGTVQRLTDFGAFVNVGGVDGLVHISQISHERVEQPSEVLEQGQKVKVKVLSVDADTQRISLSIKAAQPGPWENI 267          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1B_SYNY3 (30S ribosomal protein S1 homolog B OS=Synechocystis sp. (strain PCC 6803) GN=rps1b PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.163e-15
Identity = 43/119 (36.13%), Postives = 72/119 (60.50%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAM-ADSQAQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEM 402
            E +++ ++LVL+ R+   A+S  ++  G++  G V  ++PYG F++I G+ GLLHVSQ+S  RV  + T+   G  + V +   D  + R+SLST+ LE  PG+++       EK +EM
Sbjct:  167 EANQDNNKLVLTQRRIQQAESMGKIAAGNIYEGKVAKIQPYGVFVEIEGVTGLLHVSQVSGTRVDSLNTLFAFGQAISVYVQEIDEYKNRISLSTRILETYPGELV-------EKFDEM 278          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1_STAAW (30S ribosomal protein S1 OS=Staphylococcus aureus (strain MW2) GN=rpsA PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-15
Identity = 48/115 (41.74%), Postives = 68/115 (59.13%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQ---------AQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIR 366
            E+D E +R++LS RKA+   +           L  G V+ G V  L  +GAFIDIGG++GL+HVS++SH+ V     V+  G  +KV I S DR+  R+SLS K   PTP + I+
Sbjct:  160 ELDPENNRVILS-RKAVEQEENDAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKDTLPTPFENIK 273          
BLAST of EY659216 vs. ExPASy Swiss-Prot
Match: RS1_STAAS (30S ribosomal protein S1 OS=Staphylococcus aureus (strain MSSA476) GN=rpsA PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.535e-15
Identity = 48/115 (41.74%), Postives = 68/115 (59.13%), Query Frame = 1
Query:   49 EVDEEQSRLVLSNRKAMADSQ---------AQLGIGSVVIGTVQSLKPYGAFIDIGGINGLLHVSQISHDRVADIATVLQPGDTLKVMILSHDRERGRVSLSTKKLEPTPGDMIR 366
            E+D E +R++LS RKA+   +           L  G V+ G V  L  +GAFIDIGG++GL+HVS++SH+ V     V+  G  +KV I S DR+  R+SLS K   PTP + I+
Sbjct:  160 ELDPENNRVILS-RKAVEQEENDAKKDQLLQSLNEGDVIDGKVARLTQFGAFIDIGGVDGLVHVSELSHEHVQTPEEVVSIGQDVKVKIKSIDRDTERISLSIKDTLPTPFENIK 273          
The following BLAST results are available for this feature:
BLAST of EY659216 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
RR1_SPIOL1.644e-8693.6830S ribosomal protein S1, chloroplastic OS=Spinaci... [more]
RS1_SYNP61.411e-3756.5930S ribosomal protein S1 OS=Synechococcus sp. (str... [more]
RS1A_SYNY31.236e-3353.7330S ribosomal protein S1 homolog A OS=Synechocysti... [more]
RS1_LEULA2.956e-1947.3240S ribosomal protein S1 OS=Leuconostoc lactis GN=... [more]
RS1_SYNE74.269e-1835.4330S ribosomal protein S1 OS=Synechococcus elongatu... [more]
RS1H_BACSU4.269e-1842.4830S ribosomal protein S1 homolog OS=Bacillus subti... [more]
RS1H_BACC11.622e-1742.4830S ribosomal protein S1 homolog OS=Bacillus cereu... [more]
RS1B_SYNY31.163e-1536.1330S ribosomal protein S1 homolog B OS=Synechocysti... [more]
RS1_STAAW7.535e-1541.7430S ribosomal protein S1 OS=Staphylococcus aureus ... [more]
RS1_STAAS7.535e-1541.7430S ribosomal protein S1 OS=Staphylococcus aureus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659216 ID=EY659216|Name=EY659216|organism=Citrus sinensis|type=EST|length=713bp
AATCAACTGCAGAAGAGCTTCTCGGTAAAGACTTCCTCTAAGTTTGTGGA
GGTTGATGAGGAACAGTCTAGGCTTGTCCTAAGTAACCGCAAGGCCATGG
CTGACAGCCAGGCACAGCTAGGAATTGGATCAGTGGTCATTGGTACTGTA
CAGAGCCTGAAACCATATGGTGCCTTCATTGACATTGGTGGAATCAATGG
TCTTCTTCATGTCAGTCAGATCAGTCACGATCGTGTGGCTGATATTGCTA
CAGTGCTTCAACCTGGTGATACTCTCAAGGTCATGATACTGAGCCATGAC
CGAGAGAGAGGCCGTGTCAGTCTTTCAACAAAGAAGTTAGAACCTACCCC
TGGAGACATGATTCGCAATCCAAAACTTGTTTTTGAGAAGGCTGAGGAGA
TGGCACAAACATTCAGGCAGAGAATTGCTCAAGCAGAAGCCATGGCTCGT
GCAGACATGCTTAGATTCCAGCCTGAGAGTGGCTTAACTCTTAACTCGGA
TGGGATCTTGGGTCCACTTTCACCTGACTTGCCGGCGGATGGATTAGATT
TGACTGACATTTCCCCAGCTGATGATTGAACTTAAATAGCAGTTGTATTG
TATCTTTTGCAACCCAAGACATATTATTAATTNTGTAAAATTTACTGCGA
TTGAAACTTCCAGCCAAATATGCAACTTCAAATTTTTTCCTCTTGGTTNA
AAAAAAAAAANNA
back to top