EY659213

Overview
NameEY659213
Unique NameEY659213
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length837
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3127 contig Csv1_Contig3127:35..870. Citrus sinensis Unigene version 1.0 (Csv1)
Homology
BLAST of EY659213 vs. ExPASy Swiss-Prot
Match: EIF3A_TOBAC (Eukaryotic translation initiation factor 3 subunit A OS=Nicotiana tabacum GN=TIF3A1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.216e-12
Identity = 47/127 (37.01%), Postives = 62/127 (48.82%), Query Frame = 2
Query:   35 EKLKKEEAERQAKLDELAXXXXXXXXXXXXXXXXXXXAILGRSSDGASKPFEPPV--RTSKPGSXXXXXXXXXXXXTSG--KYIPRHLRAKMEGAGVGGQSAPPQSEERWAGGTRPE---QWGPSRR 394
            E+ KKEEAERQAKLDE+A                    IL +S+    KP EPP   R ++ G             T G  KY+P+HLR KM+GAG     APP   ++W GG++P+    W   R+
Sbjct:  819 ERRKKEEAERQAKLDEIAEKQRRRMLELEEKEKREREEILRKSTAVLPKPAEPPTLGRPAELGGAAPIPAAAATAPTPGPGKYVPKHLRTKMDGAG----QAPPPETDKWGGGSKPDDRPSWRDERK 941          
The following BLAST results are available for this feature:
BLAST of EY659213 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
EIF3A_TOBAC1.216e-1237.01Eukaryotic translation initiation factor 3 subunit... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F06-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659213 ID=EY659213|Name=EY659213|organism=Citrus sinensis|type=EST|length=837bp
GGTGCCGGNATTAAAGCCCCGACCCACGCGTCCGGAGAAACTAAAGAAGG
AAGAAGCTGAACGCCAGGCAAAATTGGATGAGCTTGCTGAAAAACAGAGG
CAAAGAGAGCGAGAGCTTGATGAAAAAGAACGACTCAGAAAAGAAGCTAT
CTTGGGGAGGTCATCTGATGGGGCTTCTAAACCTTTCGAGCCTCCTGTTC
GTACATCAAAGCCTGGATCTGCTGCTCCTGCTGCAGCTGCAGCCGCAGCT
GCACCAACCTCTGGAAAATACATCCCCAGGCACCTGCGTGCGAAAATGGA
AGGTGCAGGTGTAGGTGGGCAATCAGCACCTCCTCAATCTGAGGAGCGGT
GGGCTGGCGGTACCAGACCAGAACAATGGGGGCCCAGCAGGCGGACTGAC
GGTTCCAGTCAGGCTCCACCTGAAGCTGATCGCTGGGGCAGGCCAGATGA
TCGCTCAGGCCCACCCAGTGATAGGTGGCGTCCTGGTGGGGGCTCAAGGT
CATCCTCCACTTGGTCGTCATCCAGACCACCACGTTGACCTCTCCACTTT
GATCAAGGATTGCTTCTGGCTGATGCTTAAATTGGGATATCTTGATTNTA
TGCTGAAATGTCGATGGGTTTTTGTTGATACGAGCTCAAGAGGAAACTTG
GGACTTGCTAGAGTTATTTGTTATTCACTTTTTTTTTTCCATTTTTTTTT
TTAAATTTTTGGCTTTGTATGGGAAAACCCGAGGATATTTATTGTAGTCC
GAAGCAGGCACTCGAAGATTTTTGACACTCAAAACTTGGTACAGTTGAAT
TGGCAAAAAAAAAAAAAAAAAGGAAAAAAAAAAAAAA
back to top