EY659085

Overview
NameEY659085
Unique NameEY659085
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length920
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: TMVRN_NICGU (TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 5.108e-31
Identity = 81/196 (41.33%), Postives = 119/196 (60.71%), Query Frame = 1
Query:   28 MHLDGTALEELPSSI-ECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYF-GRNKGLSLPITFSVDGLQNLRDLNLNDCGIME--LPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLP--CNLLSXDAH 597
            +H+ G+ + ELPSSI +  + ++ L L + K+L +LPS +C+LKSL  L + GCS L+ LPEE+G+L+ L +  A  T I   P SI+RL ++  + F G   G+        +GL +L  LNL+ C +++  LPE +G LSS+  L L  NNFE +P SI QL  L+ L ++ C+RL  LP+LP   N L  D H
Sbjct:  717 IHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFRGFKDGVHFEFPPVAEGLHSLEYLNLSYCNLIDGGLPEEIGSLSSLKKLDLSRNNFEHLPSSIAQLGALQSLDLKDCQRLTQLPELPPELNELHVDCH 912          

HSP 2 Score: 75.8702 bits (185), Expect = 3.678e-13
Identity = 56/164 (34.15%), Postives = 87/164 (53.05%), Query Frame = 1
Query:   49 LEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLK-RVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIME-LPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIR 534
            LEE+  S+ C SK+  L L DCKSLK  P     ++SL+ L +  C +L++LPE  G ++    +H  G+ I E+P SI + K  V  +     K L + +  S+  L++L  L+++ C  +E LPE +G L ++           R P SII+L+ L  L  R
Sbjct:  655 LEEVHHSLGCCSKVIGLYLNDCKSLKRFPC--VNVESLEYLGLRSCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNL-VALPSSICRLKSLVSLSVSGCSKLESLPEEIGDLDNLRVFDASDTLILRPPSSIIRLNKLIILMFR 815          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: LRRC7_RAT (Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.034e-15
Identity = 61/182 (33.52%), Postives = 96/182 (52.75%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+T ++L+   LE LP++   L KL  L L +   LK+LP  + KL  L+ L + G +    LPE L  ++ L  L     ++  +P SI +LK +  +Y   +K     +   + G + L DL L+   + +LP+S+GLL  +TTL ++ N    +P +I  LS LE  F   C  L+SLP
Sbjct:  144 NLTQLYLNDAFLEFLPANFGRLVKLRILELRE-NHLKTLPKSMHKLAQLERLDL-GNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKML--VYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEE-FDCSCNELESLP 320          

HSP 2 Score: 68.1662 bits (165), Expect = 7.668e-11
Identity = 53/182 (29.12%), Postives = 94/182 (51.65%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+  + +D  AL+ LP SI  L  L +L ++  + ++++   +   ++L+ L++   + LQ+LP+ +G L+ L  L      +T +P +I  L  +       N+  SLP T     L +LR L +++  + ELP  +G   +VT + L  N  E +PE I Q+  L R+      RL++LP
Sbjct:  213 NLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNR-IETVDMDISGCEALEDLLLSS-NMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPPTIGY--LHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQRL-RVLNLSDNRLKNLP 389          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: LRRC7_MOUSE (Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.034e-15
Identity = 61/182 (33.52%), Postives = 96/182 (52.75%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+T ++L+   LE LP++   L KL  L L +   LK+LP  + KL  L+ L + G +    LPE L  ++ L  L     ++  +P SI +LK +  +Y   +K     +   + G + L DL L+   + +LP+S+GLL  +TTL ++ N    +P +I  LS LE  F   C  L+SLP
Sbjct:  139 NLTQLYLNDAFLEFLPANFGRLVKLRILELRE-NHLKTLPKSMHKLAQLERLDL-GNNEFSELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKML--VYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEE-FDCSCNELESLP 315          

HSP 2 Score: 68.1662 bits (165), Expect = 7.668e-11
Identity = 53/182 (29.12%), Postives = 94/182 (51.65%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+  + +D  AL+ LP SI  L  L +L ++  + ++++   +   ++L+ L++   + LQ+LP+ +G L+ L  L      +T +P +I  L  +       N+  SLP T     L +LR L +++  + ELP  +G   +VT + L  N  E +PE I Q+  L R+      RL++LP
Sbjct:  208 NLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNR-IETVDMDISGCEALEDLLLSS-NMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPPTIGY--LHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQRL-RVLNLSDNRLKNLP 384          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: LRRC7_HUMAN (Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.764e-15
Identity = 61/182 (33.52%), Postives = 96/182 (52.75%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+T ++L+   LE LP++   L KL  L L +   LK+LP  + KL  L+ L + G +    LPE L  ++ L  L     ++  +P SI +LK +  +Y   +K     +   + G + L DL L+   + +LP+S+GLL  +TTL ++ N    +P +I  LS LE  F   C  L+SLP
Sbjct:  139 NLTQLYLNDAFLEFLPANFGRLVKLRILELRE-NHLKTLPKSMHKLAQLERLDL-GNNEFGELPEVLDQIQNLRELWMDNNALQVLPGSIGKLKML--VYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEE-FDCSCNELESLP 315          

HSP 2 Score: 68.5514 bits (166), Expect = 5.872e-11
Identity = 53/182 (29.12%), Postives = 94/182 (51.65%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            N+  + +D  AL+ LP SI  L  L +L ++  + ++++   +   ++L+ L++   + LQ+LP+ +G L+ L  L      +T +P +I  L  +       N+  SLP T     L +LR L +++  + ELP  +G   +VT + L  N  E +PE I Q+  L R+      RL++LP
Sbjct:  208 NLRELWMDNNALQVLPGSIGKLKMLVYLDMSKNR-IETVDMDISGCEALEDLLLSS-NMLQQLPDSIGLLKKLTTLKVDDNQLTMLPNTIGNLSLLEEFDCSCNELESLPSTIGY--LHSLRTLAVDENFLPELPREIGSCKNVTVMSLRSNKLEFLPEEIGQMQKL-RVLNLSDNRLKNLP 384          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: LRC69_XENLA (Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.702e-15
Identity = 58/188 (30.85%), Postives = 96/188 (51.06%), Query Frame = 1
Query:    7 VRGNITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLP---SGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLP 561
            +RG   T++L+G  L+ +P ++ CL  L+ L L +   L  LP   S LC+L+ L +    G ++ +++PEE+  L+ L+ LH  G  I+E+P +                        ++DGL NL  LNLN+  +  LP  +  L S+ TL +  N+ + IP+ +  L NL+ L +    +L SLP
Sbjct:   10 IRGKAKTLNLNGKRLQRVPVAVGCLISLTELQLKN-NLLCRLPVELSALCRLRVLHL----GNNHFEKVPEEIKYLKCLERLHLFGNRISEIPAA------------------------ALDGLDNLLFLNLNNNLLEHLPREIYKLQSLETLSINNNHMKAIPKELCFLQNLQELHLAN-NQLDSLP 167          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: DRL25_ARATH (Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.143e-14
Identity = 58/202 (28.71%), Postives = 106/202 (52.48%), Query Frame = 1
Query:   28 MHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGR-NKGLSLPITFSVDGLQNLRDLNLNDCGIMELPE-SLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLP--CNLLSXDAHHCTALESL 621
            + +  T+L EL  +I  +  L+ L L +C  ++ LPS + KL  L+V  + GC  L+ +    G +  L  ++   T+++E+P  I  L  ++ +   + +K  +LP   +++ L NL   +++ C  +E  E S   LS +  ++L   N   +P  I +LSNL+ L +R C +L++LP L    +L+  D   CT L+ +
Sbjct:  684 LDMSKTSLPELADTIADVVNLNKLLLRNCSLIEELPS-IEKLTHLEVFDVSGCIKLKNINGSFGEMSYLHEVNLSETNLSELPDKISELSNLKELIIRKCSKLKTLP---NLEKLTNLEIFDVSGCTELETIEGSFENLSCLHKVNLSETNLGELPNKISELSNLKELILRNCSKLKALPNLEKLTHLVIFDVSGCTNLDKI 881          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: SUR8_CULQU (Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.326e-14
Identity = 62/192 (32.29%), Postives = 98/192 (51.04%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSXD 591
            ++   +L G  +  LP  I CLS L  L L +  SL SLP  L  LK+L VL +   + L  +P+ +  L  L  L+     I  V  ++  L  +  +    NK   LP   ++  L+NL  L+L+   +  LPE++G   ++T L L+ N+   IPE+I  L+NL+RL +RY  +L ++P    N +  D
Sbjct:  171 SLIEFYLYGNKISSLPVEIGCLSNLKTLALNE-NSLTSLPDSLQNLKALKVLDLRH-NKLSEIPDVIYKLHTLTTLYLRFNRIKVVGDNLKNLSSLTMLSLRENKIHELPA--AIGHLRNLTTLDLSHNHLKHLPEAIGNCVNLTALDLQHNDLLDIPETIGNLANLQRLGLRY-NQLTAIPVSLRNCIHMD 357          

HSP 2 Score: 70.0922 bits (170), Expect = 2.018e-11
Identity = 57/204 (27.94%), Postives = 106/204 (51.96%), Query Frame = 1
Query:   16 NITTMHLDGTALEELPSSIECLSK-LSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSXDAHHCTALESLP 624
            N+T+++++   ++++   I   +K L+ L + +  +L SLP  +     + V +  G ++L +LP+++  L+ L+IL      +  +P +I  LK++R +    N+  SLP    +  L +L+ L L    +  LP ++G L+++T L +  NN + +PE I  L NLE L+I       SL KLP  L         ++E+ P
Sbjct:  403 NVTSINMEHNQIDKIQYGIFSRAKGLTKLNMKE-NALTSLPLDIGTWSQM-VELNFGTNSLAKLPDDIHCLQNLEILILSNNMLKRIPNTIGNLKKLRVLDLEENRLESLPSEIGL--LHDLQKLILQSNALQSLPRTIGHLTNLTYLSVGENNLQYLPEEIGTLENLESLYI---NDNASLVKLPYELALCQNLAIMSIENCP 599          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: SHOC2_RAT (Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.674e-14
Identity = 62/201 (30.85%), Postives = 100/201 (49.75%), Query Frame = 1
Query:   19 ITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSXDAHHCTALESL 621
            +T ++L    L+ LP+ + CL  L  L L++  SL SLP  L  LK L +L +   + L+ +P  +  L++L  L+     IT V   +  L R+  +    NK   LP    +  L NL  L++    +  LP+ +G  + +T L L+ N    +P++I  LS+L RL +RY  RL ++P+            C+ALE L
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSE-NSLTSLPDSLDNLKKLRMLDLRH-NKLREIPSVVYRLDSLTTLYLRFNRITAVEKDVRNLPRLSTLSIRENKIKQLPA--EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLNRLGLRY-NRLSAIPR--------SLAKCSALEEL 312          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: SHOC2_CHICK (Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 5.674e-14
Identity = 60/182 (32.97%), Postives = 93/182 (51.10%), Query Frame = 1
Query:   19 ITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPK 564
            +T ++L    L+ LP+ + CL  L  L L++  SL SLP  L  LK L +L +   + L+ +P  +  L +L  L+     IT V   I  L ++  +    NK   LP    +  L NL  L++    +  LPE +G  + +T L L+ N    +PE+I  LS+L RL +RY  RL ++PK
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLVTLALSE-NSLTSLPDSLDNLKKLRMLDLRH-NKLREIPSVVYRLTSLATLYLRFNRITTVEKDIKTLSKLTMLSIRENKIKQLPA--EIGELCNLITLDVAHNQLEHLPEEIGSCTQITNLDLQHNELLDLPETIGNLSSLSRLGLRY-NRLSAIPK 301          
BLAST of EY659085 vs. ExPASy Swiss-Prot
Match: SHOC2_PONAB (Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 7.410e-14
Identity = 62/201 (30.85%), Postives = 100/201 (49.75%), Query Frame = 1
Query:   19 ITTMHLDGTALEELPSSIECLSKLSHLGLADCKSLKSLPSGLCKLKSLDVLIIDGCSNLQRLPEELGNLEALDILHAIGTSITEVPPSIVRLKRVRGIYFGRNKGLSLPITFSVDGLQNLRDLNLNDCGIMELPESLGLLSSVTTLHLEGNNFERIPESIIQLSNLERLFIRYCERLQSLPKLPCNLLSXDAHHCTALESL 621
            +T ++L    L+ LP+ + CL  L  L L++  SL SLP  L  LK L +L +   + L+ +P  +  L++L  L+     IT V   I  L ++  +    NK   LP    +  L NL  L++    +  LP+ +G  + +T L L+ N    +P++I  LS+L RL +RY  RL ++P+            C+ALE L
Sbjct:  125 LTELYLYSNKLQSLPAEVGCLVNLMTLALSE-NSLTSLPDSLDNLKKLRMLDLRH-NKLREIPSVVYRLDSLTTLYLRFNRITTVEKDIKNLSKLSMLSIRENKIKQLPA--EIGELCNLITLDVAHNQLEHLPKEIGNCTQITNLDLQHNELLDLPDTIGNLSSLSRLGLRY-NRLSAIPR--------SLAKCSALEEL 312          
The following BLAST results are available for this feature:
BLAST of EY659085 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
TMVRN_NICGU5.108e-3141.33TMV resistance protein N OS=Nicotiana glutinosa GN... [more]
LRRC7_RAT1.034e-1533.52Leucine-rich repeat-containing protein 7 OS=Rattus... [more]
LRRC7_MOUSE1.034e-1533.52Leucine-rich repeat-containing protein 7 OS=Mus mu... [more]
LRRC7_HUMAN1.764e-1533.52Leucine-rich repeat-containing protein 7 OS=Homo s... [more]
LRC69_XENLA6.702e-1530.85Leucine-rich repeat-containing protein 69 OS=Xenop... [more]
DRL25_ARATH1.143e-1428.71Putative disease resistance protein At4g19050 OS=A... [more]
SUR8_CULQU3.326e-1432.29Leucine-rich repeat protein soc-2 homolog OS=Culex... [more]
SHOC2_RAT5.674e-1430.85Leucine-rich repeat protein SHOC-2 OS=Rattus norve... [more]
SHOC2_CHICK5.674e-1432.97Leucine-rich repeat protein SHOC-2 OS=Gallus gallu... [more]
SHOC2_PONAB7.410e-1430.85Leucine-rich repeat protein SHOC-2 OS=Pongo abelii... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-C04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659085 ID=EY659085|Name=EY659085|organism=Citrus sinensis|type=EST|length=920bp
CCACGCGTCCGCGGTAATATAACAACGATGCATTTAGATGGAACTGCACT
GGAGGAACTGCCTTCGTCCATCGAGTGTCTATCTAAGCTTTCGCACTTGG
GCCTTGCAGATTGTAAAAGTCTCAAGAGTCTCCCAAGCGGCCTGTGTAAG
TTGAAATCTCTAGATGTTCTCATTATCGATGGTTGCTCGAATCTTCAGAG
ATTGCCCGAGGAACTTGGAAATTTAGAAGCTTTGGATATTTTGCACGCTA
TAGGAACTTCTATAACAGAAGTACCGCCATCCATCGTCCGTTTGAAAAGG
GTTCGTGGAATATATTTCGGGAGAAACAAGGGTTTATCATTGCCAATCAC
ATTCTCTGTAGATGGCTTGCAAAATCTAAGGGATTTAAATCTAAATGATT
GCGGCATCATGGAGTTACCTGAAAGTCTTGGCCTGTTATCCTCAGTAACA
ACACTGCATCTAGAGGGAAACAATTTTGAGAGAATACCAGAAAGCATCAT
ACAACTTTCTAATTTGGAAAGGCTCTTCATAAGGTATTGCGAGAGGCTTC
AATCCTTACCAAAGCTTCCATGCAATCTACTTTCGNTGGATGCACATCAT
TGCACCGCACTGGAATCATTACCAGGTTATTCCCCAGTAGTGATGAATCT
TATTTACGGACTTTATACCTGAGCGATAATTTAATTNGNATCNGAATGAG
ATTAGAGGGTTTGTCAAAGGAGCTCTGCAGAAAATTCACTTTTGGCAACG
CACGTCTAGAGAAACACGGAAAAGGNATGCGTTAATACTCTCCTTTTATT
TAAAAAGAGCTTAAGAAAGATGCCGATGACCATACCCGGGGGGGGGAATA
TATGGTAATGATACTTGCCCCCTTCTTGACGCCATATTTTACGTAATTCA
ACTTTCCGATAAATTTCGGT
back to top