EY659083

Overview
NameEY659083
Unique NameEY659083
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length879
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3548 contig Csv1_Contig3548:386..1268. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN6_ARATH (Endoglucanase 6 OS=Arabidopsis thaliana GN=At1g64390 PE=2 SV=2)

HSP 1 Score: 334.339 bits (856), Expect = 3.503e-113
Identity = 154/188 (81.91%), Postives = 171/188 (90.96%), Query Frame = 2
Query:   11 EASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGN 574
            ++SGV+LVGGYYDAGDNVKFGLPMAFTVTMM+WS+IEYG Q+ A+GELG++++AIKWGTDYFIKAHP+PNVLYGEVGDGNTDH CWQRPE+MTTDR+AY+IDPSNPGSDLAGET       SIVFR S+P YS  LL HAYQLFDFADKYRGKYD SITVAQKYYRS+SGYNDELLWAAAWLYQAS N
Sbjct:   63 KSSGVNLVGGYYDAGDNVKFGLPMAFTVTMMAWSVIEYGNQLQANGELGNSIDAIKWGTDYFIKAHPEPNVLYGEVGDGNTDHYCWQRPEEMTTDRKAYRIDPSNPGSDLAGETAAAMAAASIVFRRSNPVYSRLLLTHAYQLFDFADKYRGKYDSSITVAQKYYRSVSGYNDELLWAAAWLYQASNN 250          

HSP 2 Score: 96.2857 bits (238), Expect = 3.503e-113
Identity = 49/77 (63.64%), Postives = 53/77 (68.83%), Query Frame = 1
Query:  574 QHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRGTTE-AEYFMCSCLGKGSRMFKK 801
            Q YLDYLG+NGD+MG TGW MT FGWDVK  G QTL AKFLMQ KAG      R   E A+ FMCS LGK SR  +K
Sbjct:  251 QFYLDYLGRNGDAMGGTGWSMTEFGWDVKYAGVQTLVAKFLMQGKAGRHAPVFRKYQEKADSFMCSLLGKSSRNIQK 327          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN19_ARATH (Endoglucanase 19 OS=Arabidopsis thaliana GN=At4g11050 PE=2 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 3.225e-111
Identity = 152/188 (80.85%), Postives = 171/188 (90.96%), Query Frame = 2
Query:   11 EASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGN 574
            ++SGVDLVGGYYDAGDNVKFGLPMAFTVT M WSIIEYG Q+ ++GELGHA++A+KWGTDYFIKAHP+PNVLYGEVGDG +DH CWQRPE+MTTDRRAYKID +NPGSDLAGET       SIVFR SDP+YS+ELLRHA+QLF+FADKYRGKYD SITVAQKYYRS+SGYNDELLWAAAWLYQA+ +
Sbjct:   64 KSSGVDLVGGYYDAGDNVKFGLPMAFTVTTMCWSIIEYGGQLESNGELGHAIDAVKWGTDYFIKAHPEPNVLYGEVGDGKSDHYCWQRPEEMTTDRRAYKIDRNNPGSDLAGETAAAMAAASIVFRRSDPSYSAELLRHAHQLFEFADKYRGKYDSSITVAQKYYRSVSGYNDELLWAAAWLYQATND 251          

HSP 2 Score: 93.2041 bits (230), Expect = 3.225e-111
Identity = 47/77 (61.04%), Postives = 52/77 (67.53%), Query Frame = 1
Query:  574 QHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSL-RGTTEAEYFMCSCLGKGSRMFKK 801
            ++YLDYLGKNGDSMG TGW MT FGWDVK  G QTL AK LMQ K G       R   +AE FMCS LGK ++  KK
Sbjct:  252 KYYLDYLGKNGDSMGGTGWSMTEFGWDVKYAGVQTLVAKVLMQGKGGEHTAVFERYQQKAEQFMCSLLGKSTKNIKK 328          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN2_ORYSJ (Endoglucanase 2 OS=Oryza sativa subsp. japonica GN=GLU5 PE=1 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.592e-104
Identity = 142/186 (76.34%), Postives = 165/186 (88.71%), Query Frame = 2
Query:   11 EASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQAS 568
            +A+GVDLVGGYYDAGDNVKFGLPMAFTVTMM+WS+IEYG++MAA+GELGHA+ AIKWGTDYF KAHP+PNVLY EVGDG++DHNCWQRPEDMTT R+AY++DP NPGSDLAGET       S+VFR S+P Y+ +LL+H+ QLFDFADKYRG+YD SITVA+ YY S SGY DELLWA+AWLYQAS
Sbjct:   78 KANGVDLVGGYYDAGDNVKFGLPMAFTVTMMAWSVIEYGEEMAAAGELGHAVEAIKWGTDYFAKAHPEPNVLYAEVGDGDSDHNCWQRPEDMTTSRQAYRLDPQNPGSDLAGETAAAMAAASLVFRSSNPGYADQLLQHSKQLFDFADKYRGRYDNSITVARNYYGSFSGYGDELLWASAWLYQAS 263          

HSP 2 Score: 84.7297 bits (208), Expect = 3.592e-104
Identity = 39/70 (55.71%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  574 QHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRG-TTEAEYFMCSCLGK 780
            + YLDYL  N D++G TGW +  FGWDVK PG Q L AKFL+Q KAG     L+G   +A++F CSCLGK
Sbjct:  266 RRYLDYLANNADALGGTGWSINQFGWDVKYPGVQILAAKFLLQGKAGEHAGVLQGYRRKADFFACSCLGK 335          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN1_ORYSJ (Endoglucanase 1 OS=Oryza sativa subsp. japonica GN=GLU7 PE=2 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 1.487e-102
Identity = 137/188 (72.87%), Postives = 165/188 (87.77%), Query Frame = 2
Query:   11 EASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGN 574
            +A+GVDLVGGYYDAGDNVKFG PMAFTVTMM+WS++EYGKQMAA+GELGHAM+A++WG DYF+KAHP PNVLYGEVGDG++DH CWQRPEDMTT R+AY++DP +PGSDLAGET       S+VFR S+P Y+++LL+H+ QLFDFADKYRGKYD S+ V +K+Y S SGY DELLWA+AWLYQA+ N
Sbjct:   79 KANGVDLVGGYYDAGDNVKFGFPMAFTVTMMAWSVLEYGKQMAAAGELGHAMDAVRWGADYFVKAHPAPNVLYGEVGDGDSDHVCWQRPEDMTTSRQAYRLDPQHPGSDLAGETATALAAASLVFRSSNPGYANQLLQHSKQLFDFADKYRGKYDDSMPVVKKFYGSFSGYGDELLWASAWLYQATDN 266          

HSP 2 Score: 85.8853 bits (211), Expect = 1.487e-102
Identity = 41/71 (57.75%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  574 QHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRG-TTEAEYFMCSCLGKG 783
            + YLDYL  NGD++G TGW    FGWDVK PG Q L AKFL+Q KAG     LR     A+ F CSCLGKG
Sbjct:  267 RRYLDYLANNGDALGGTGWATNEFGWDVKYPGVQVLAAKFLLQGKAGPHAAVLRRYQRNADVFACSCLGKG 337          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN15_ORYSJ (Endoglucanase 15 OS=Oryza sativa subsp. japonica GN=Os05g0212300 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 2.328e-100
Identity = 139/186 (74.73%), Postives = 164/186 (88.17%), Query Frame = 2
Query:   11 EASGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQAS 568
            +A+GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSI+EYGKQMAA+GEL +AM+A+KWGTDYFIKAHP+P+VLYGEVGDG+TDH+CWQRPEDMTT R+A+++DP +PGSDLA ET       SIVFR + P Y++ LL H+ QLF+FADKYRGKYD SITVA+ YY S SGY DELLWAAAWL++A+
Sbjct:   72 KANGVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSILEYGKQMAAAGELRNAMDAVKWGTDYFIKAHPEPDVLYGEVGDGDTDHSCWQRPEDMTTSRQAFRVDPQHPGSDLAAETAAAMAAASIVFRGTYPGYANLLLVHSKQLFEFADKYRGKYDASITVARNYYGSFSGYGDELLWAAAWLFEAT 257          

HSP 2 Score: 84.7297 bits (208), Expect = 2.328e-100
Identity = 38/70 (54.29%), Postives = 50/70 (71.43%), Query Frame = 1
Query:  580 YLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSL-RGTTEAEYFMCSCLGKGS 786
            YL+YL  NG+++G TGW +  FGWDVK PG Q L AKFL+Q +AG    +L R    AE+F+CSC+GKG+
Sbjct:  262 YLEYLAGNGEALGGTGWSINQFGWDVKYPGVQVLAAKFLLQGRAGDHAAALQRYRQNAEFFVCSCVGKGA 331          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN7_ORYSJ (Endoglucanase 7 OS=Oryza sativa subsp. japonica GN=GLU10 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 1.665e-89
Identity = 132/186 (70.97%), Postives = 153/186 (82.26%), Query Frame = 2
Query:   20 GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNS 577
            GVDLVGGYYDAGD+VKFGLPMAFTVTM+SWS+IEYG  + A+GELGHA+ AIKWGTDYFIKAH +PN L+ EVGDG+TDH CWQRPEDMTT R+AYK+D   PGSD+AGET       SIVFR S+P Y+S LL HA QLF+FADKYRGKYD SI   + YY S+SGY DELLWAA WL++A+G +
Sbjct:   77 GVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSMIEYGDDVEAAGELGHALEAIKWGTDYFIKAHTKPNELWAEVGDGDTDHYCWQRPEDMTTSRQAYKVDRERPGSDVAGETAAAMAAASIVFRKSNPHYASLLLHHAQQLFEFADKYRGKYDSSIAEVKSYYASVSGYKDELLWAALWLHRATGKA 262          

HSP 2 Score: 64.6994 bits (156), Expect = 1.665e-89
Identity = 32/75 (42.67%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  577 HYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRGTTE-----AEYFMCSCLGKGS 786
            HYLDY+  N D  G TGW +T F WDVK  G Q L A+ L++   G   +  R T E     AE+++C CLG+ +
Sbjct:  263 HYLDYVVDNADCFGGTGWAITEFSWDVKYAGVQILAARLLLR---GEHEERHRSTLEQYRAKAEHYVCGCLGRNA 334          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN16_ORYSJ (Endoglucanase 16 OS=Oryza sativa subsp. japonica GN=Os06g0247900 PE=2 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 6.878e-88
Identity = 129/186 (69.35%), Postives = 153/186 (82.26%), Query Frame = 2
Query:   20 GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGNS 577
            GVDLVGGYYDAGD+VKFGLPMAFTVTM+SWS++EYG  +AA+GEL HA++AIKWGTDYFIKAH +P+ L+ EVGDG+TDH CWQRPEDMTT R+AYK+D   PGSD+AGET       SIVFR S+P YS  LL HA QLF+FAD YRGKYD SI   + YY S+SGY+DELLWAA WL++A+G +
Sbjct:   71 GVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSLLEYGADVAAAGELAHALDAIKWGTDYFIKAHTKPHELWAEVGDGDTDHYCWQRPEDMTTSRQAYKVDRRRPGSDVAGETAAAMAAASIVFRQSNPHYSHLLLHHAQQLFEFADTYRGKYDSSIAEVKSYYASVSGYHDELLWAALWLHRATGRA 256          

HSP 2 Score: 64.3142 bits (155), Expect = 6.878e-88
Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  580 YLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRGTTE-----AEYFMCSCLGKGS 786
            YLDY   N D  G TGW +T F WDVK  G Q L A+ LM+   G   +  RGT E     AE+++C+C+G+ +
Sbjct:  258 YLDYAVDNADEFGGTGWAITEFSWDVKYAGVQILAARLLMR---GEHEERHRGTLERYREKAEHYVCACMGRNA 328          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN5_ORYSJ (Endoglucanase 5 OS=Oryza sativa subsp. japonica GN=Os02g0151300 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 2.381e-85
Identity = 126/185 (68.11%), Postives = 152/185 (82.16%), Query Frame = 2
Query:   20 GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHS-DPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASG 571
            GVDLVGGYYDAGD+VKFGLPMAFTVTM+SWS++EYG+++AA+GELGHA++AIKWGTDYFIKAH  PNVL+ +VGDG++DH CWQRPEDMTT R AYK+D  NPGS++A ET       SIVFR + D  Y+  LL HA QLF+F DKYRG+YD S+ V + YY S SGY DELLWAA WL++A+G
Sbjct:   70 GVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSVLEYGEEIAAAGELGHALHAIKWGTDYFIKAHTHPNVLWTQVGDGDSDHYCWQRPEDMTTSRHAYKVDAENPGSEVAAETAAAMAAASIVFRRAGDAHYAHLLLHHAQQLFEFGDKYRGRYDESVEVVKNYYPSSSGYKDELLWAALWLHRATG 254          

HSP 2 Score: 63.1586 bits (152), Expect = 2.381e-85
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  571 QQHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQS---LRGTTEAEYFMCSCLGK 780
            ++ YLDY   N D  G TGW ++ F WD+K  G Q L +K L++ K  +  Q     +  ++AEY++CSC+G+
Sbjct:  255 RREYLDYAVDNADDFGGTGWAVSEFSWDIKYAGLQVLASKLLVEEKHLSSQQREVLEKYRSKAEYYVCSCMGR 327          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN11_ARATH (Endoglucanase 11 OS=Arabidopsis thaliana GN=At2g32990 PE=2 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 4.431e-84
Identity = 131/185 (70.81%), Postives = 152/185 (82.16%), Query Frame = 2
Query:   20 GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASGN 574
            GVDLVGGY+DAGD+VKFGLPMAFTVTM+SWS+IEYG  +A++GEL HA+ AIKWGTDYFIKAH  PNVL+ EVGDG+TDH CWQRPEDMTT RRA+KID +NPGSD+AGET       SIVFR ++P YS  LL HA QLF+F DKYRGKYD S+ V + YY S+SGY DELLW A WLY+A+ N
Sbjct:   80 GVDLVGGYHDAGDHVKFGLPMAFTVTMLSWSVIEYGDSLASTGELSHALEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDHYCWQRPEDMTTSRRAFKIDENNPGSDIAGETAAAMAAASIVFRSTNPHYSHLLLHHAQQLFEFGDKYRGKYDESLKVVKSYYASVSGYMDELLWGATWLYRATDN 264          

HSP 2 Score: 46.9802 bits (110), Expect = 4.431e-84
Identity = 22/70 (31.43%), Postives = 37/70 (52.86%), Query Frame = 1
Query:  574 QHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSLRG-TTEAEYFMCSCLGK 780
            +HY+ Y+      +G   W M+ F WDVK  G Q L +  L + K     + L+   ++A++++CS L K
Sbjct:  265 EHYMSYVVDMAHQLGGLSWAMSEFSWDVKFAGVQLLASMLLKEEKHKQHSKVLQQYKSKADHYLCSILNK 334          
BLAST of EY659083 vs. ExPASy Swiss-Prot
Match: GUN22_ORYSJ (Endoglucanase 22 OS=Oryza sativa subsp. japonica GN=GLU11 PE=2 SV=2)

HSP 1 Score: 270.011 bits (689), Expect = 6.315e-83
Identity = 124/184 (67.39%), Postives = 144/184 (78.26%), Query Frame = 2
Query:   20 GVDLVGGYYDAGDNVKFGLPMAFTVTMMSWSIIEYGKQMAASGELGHAMNAIKWGTDYFIKAHPQPNVLYGEVGDGNTDHNCWQRPEDMTTDRRAYKIDPSNPGSDLAGETXXXXXXXSIVFRHSDPAYSSELLRHAYQLFDFADKYRGKYDGSITVAQKYYRSISGYNDELLWAAAWLYQASG 571
            GVDLVGGYYDAGD+VKFGLPMAFTVTM+SW  I++   +AA+GE  HA+ AIKWGTDYF+KAH  P V + EVGDG+TDH CWQRPEDMTT R+AY++D  NPGSDLAGET       SIVFR SDP YS  LL HA QLF+F D YRG YD SI   + YY S+SGY+DELLWAA WL++A+G
Sbjct:   96 GVDLVGGYYDAGDHVKFGLPMAFTVTMLSWGAIDFAADIAAAGEWRHALEAIKWGTDYFVKAHTHPFVYWAEVGDGDTDHYCWQRPEDMTTSRQAYRVDRDNPGSDLAGETAAALAAASIVFRRSDPHYSHLLLHHAQQLFEFGDTYRGSYDSSIEEVRSYYASVSGYHDELLWAALWLHRATG 279          

HSP 2 Score: 59.6918 bits (143), Expect = 6.315e-83
Identity = 32/77 (41.56%), Postives = 42/77 (54.55%), Query Frame = 1
Query:  571 QQHYLDYLGKNGDSMGRTGWGMTXFGWDVKXPGXQTLXAKFLMQSKAGTMPQSL--RGTTE-----AEYFMCSCLGK 780
            ++ YL Y   N DS G  GW +T F WDVK  G Q L AK L+       PQ+   RG  E     AE+++C+CLG+
Sbjct:  280 KEEYLRYAVDNADSFGGVGWAITEFSWDVKYAGLQVLAAKLLLDGD----PQAAAHRGVLEKYREKAEHYLCACLGR 352          
The following BLAST results are available for this feature:
BLAST of EY659083 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
GUN6_ARATH3.503e-11381.91Endoglucanase 6 OS=Arabidopsis thaliana GN=At1g643... [more]
GUN19_ARATH3.225e-11180.85Endoglucanase 19 OS=Arabidopsis thaliana GN=At4g11... [more]
GUN2_ORYSJ3.592e-10476.34Endoglucanase 2 OS=Oryza sativa subsp. japonica GN... [more]
GUN1_ORYSJ1.487e-10272.87Endoglucanase 1 OS=Oryza sativa subsp. japonica GN... [more]
GUN15_ORYSJ2.328e-10074.73Endoglucanase 15 OS=Oryza sativa subsp. japonica G... [more]
GUN7_ORYSJ1.665e-8970.97Endoglucanase 7 OS=Oryza sativa subsp. japonica GN... [more]
GUN16_ORYSJ6.878e-8869.35Endoglucanase 16 OS=Oryza sativa subsp. japonica G... [more]
GUN5_ORYSJ2.381e-8568.11Endoglucanase 5 OS=Oryza sativa subsp. japonica GN... [more]
GUN11_ARATH4.431e-8470.81Endoglucanase 11 OS=Arabidopsis thaliana GN=At2g32... [more]
GUN22_ORYSJ6.315e-8367.39Endoglucanase 22 OS=Oryza sativa subsp. japonica G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-C01-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659083 ID=EY659083|Name=EY659083|organism=Citrus sinensis|type=EST|length=879bp
CCACGCGTCCGAAGCCAGTGGGGTGGATCTTGTAGGAGGATACTATGACG
CAGGGGACAATGTGAAATTTGGATTGCCAATGGCATTCACCGTGACAATG
ATGTCTTGGAGCATAATTGAATATGGAAAGCAGATGGCTGCAAGTGGAGA
GCTTGGCCATGCCATGAATGCTATTAAGTGGGGCACTGATTACTTCATTA
AAGCTCACCCTCAGCCTAATGTCCTCTATGGAGAGGTGGGAGATGGAAAC
ACTGACCATAACTGCTGGCAAAGGCCGGAGGATATGACTACTGACAGGCG
GGCTTACAAGATTGATCCGAGTAACCCCGGGTCGGATCTTGCCGGTGAAA
CCGCCGCCGCCATGGCTGCCGCCTCCATCGTTTTCCGCCACTCTGACCCT
GCTTACTCCAGTGAGCTACTCCGCCACGCTTACCAGCTCTTTGATTTCGC
CGACAAATACAGAGGAAAATATGACGGCAGTATCACTGTGGCACAAAAAT
ACTACCGTTCTATCAGTGGCTACAATGATGAGTTGCTTTGGGCTGCTGCG
TGGTTGTATCAAGCAAGTGGCAACAGCACTACTTGGACTACCTTGGAAAA
AATGGTGACTCCATGGGAAGAACTGGCTGGGGAATGACTNGATTTGGATG
GGATGTGAAGNATCCGGGGGNTCAAACACTTGNTGCCAAGTTCTTGATGC
AAAGCAAAGCTGGAACTATGCCCCAGTCTTTGAGAGGTACAACAGAAGCA
GAATACTTTATGTGTTCTTGCCTGGGAAAAGGCTCCCGGATGTTCAAAAA
ACACCTGNTGGCCTAATCTTCCGCCAAGATGNAACACATGCANTTCGGGA
CCANGCTTTCTTTCTGGCACGCGCTATCT
back to top