EY659081

Overview
NameEY659081
Unique NameEY659081
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length874
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659081_ssr234 microsatellite EY659081_ssr234:234..248. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of EY659081 vs. ExPASy Swiss-Prot
Match: TRPE_ARATH (Anthranilate synthase component I-1, chloroplastic OS=Arabidopsis thaliana GN=ASA1 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 7.318e-44
Identity = 92/181 (50.83%), Postives = 118/181 (65.19%), Query Frame = 3
Query:   69 MNAGTAATSMQSLSFSNRLVPP--SHRLSLVPVTVTRINLPKSAATVS--TVKCCVSRQXXXXXXXXXXXXXKLASDASGFSEASKRANLVPLYRCIFSDHLTPVVAYRCLVQEDDREAPSFLFESVEPGVRVSNVGRYSVVGAQPVMEVIVKDNNVTIMDHEKGSLXEEVGDDPMEIPXK 599
            M++     +MQ+L+FS RL+P   S  LS   VTVT  +   SA   S  ++KC                   + SD    ++ASK  NL+P+YRCIFSD LTPV+AYRCLV+EDDREAPSFLFESVEPG ++S+VGRYSVVGAQP ME++ K+N V +MDH   ++ EE  +DPMEIP K
Sbjct:    1 MSSSMNVATMQALTFSRRLLPSVASRYLSSSSVTVTGYSGRSSAYAPSFRSIKCV-----------SVSPEASIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFLFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHNNETMTEEFVEDPMEIPRK 170          

HSP 2 Score: 30.4166 bits (67), Expect = 7.318e-44
Identity = 22/47 (46.81%), Postives = 28/47 (59.57%), Query Frame = 2
Query:  596 KISEDWSLK---YRRTPELFAGXGWL--FLDDTVRYVEKKSY-FSQA 718
            KISE W+      +  P+ F G GW+  F  DTVRYVEK+   FS+A
Sbjct:  170 KISEKWNPDPQLVQDLPDAFCG-GWVGFFSYDTVRYVEKRKLPFSKA 215          
BLAST of EY659081 vs. ExPASy Swiss-Prot
Match: TRPX_ARATH (Anthranilate synthase component I-2, chloroplastic OS=Arabidopsis thaliana GN=ASA2 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 9.825e-37
Identity = 77/127 (60.63%), Postives = 94/127 (74.02%), Query Frame = 3
Query:  297 FSEASKRANLVPLYRCIFSDHLTPVVAYRCLVQEDDREAPSFLFESVEPGVRVSNVGRYSVVGAQPVMEVIVKDNNVTIMDHEKGSLXEEVGDDPMEIPXK-FPRIGASNIDEL-LSFLRGXGGYFS 671
            F +AS++ NLVPL+RC+FSDHLTP++AYRCLV+EDDR+APSFLFESVEPG + SN+GRYSVVGAQP +E++ K N VT+MDH      EE  DDPM +P K         IDEL  +F  G  GYFS
Sbjct:   85 FKKASEKGNLVPLFRCVFSDHLTPILAYRCLVKEDDRDAPSFLFESVEPGSQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGASLRTEEEVDDPMMVPQKIMEEWNPQGIDELPEAFCGGWVGYFS 211          
The following BLAST results are available for this feature:
BLAST of EY659081 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
TRPE_ARATH7.318e-4450.83Anthranilate synthase component I-1, chloroplastic... [more]
TRPX_ARATH9.825e-3760.63Anthranilate synthase component I-2, chloroplastic... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659081 ID=EY659081|Name=EY659081|organism=Citrus sinensis|type=EST|length=874bp
CCACGCGTCCGGCTTCAACCGGAGACTGGCGCTATCGATTTTTGAGTTAT
TTATTTGTTCTTGTAGCGATGAATGCAGGCACAGCGGCAACATCAATGCA
ATCCCTAAGCTTCTCCAACCGCTTGGTCCCACCCAGTCATCGGCTGTCTC
TTGTTCCGGTCACCGTCACCCGCATTAACCTCCCCAAGTCCGCAGCAACT
GTCAGTACAGTCAAGTGCTGCGTTTCTCGCCAGACCACCACCACCACCAG
CACCGCCACCGCCCCTGCTACTAAGTTAGCGAGTGATGCATCAGGATTTA
GTGAAGCTTCCAAAAGGGCAAATTTGGTACCCTTATACCGTTGCATATTC
TCGGACCACCTTACTCCGGTGGTTGCATATCGGTGTTTGGTTCAAGAAGA
TGACAGAGAGGCTCCGAGTTTTTTATTTGAATCAGTGGAGCCCGGTGTTC
GGGTTTCAAATGTTGGGAGGTATAGTGTGGTTGGAGCTCAGCCTGTGATG
GAAGTTATCGTGAAAGATAATAATGTTACAATAATGGATCATGAGAAAGG
GAGCTTANTCGAGGAGGTTGGTGATGATCCGATGGAGATTCCANGAAAAT
TTCCGAGGATTGGAGCCTCAAATATCGACGAACTCCTGAGCTTTTTGCGG
GGGNTGGGTGGTTATTTCTCGATGATACCGTTCGCTATGTGGAGAAGAAA
AGCTACTTTTCTCAAGCACACATGATGATAGAGTCTGCAAAATACTCTGG
GCCTCTATATGAGGGCTGGCTTTGACCCCTGAAAAAAAGTTTTGTATTCT
TTGGGGAGGTGATCACCTCCCTGTCCAAAAAATTGCTAAGATTGAACCTT
GAAAAGGGGGCCAAAAAGAATTTT
back to top