EY659080

Overview
NameEY659080
Unique NameEY659080
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length820
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659080 vs. ExPASy Swiss-Prot
Match: SKI25_ARATH (F-box/kelch-repeat protein SKIP25 OS=Arabidopsis thaliana GN=SKIP25 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.290e-39
Identity = 85/173 (49.13%), Postives = 109/173 (63.01%), Query Frame = 1
Query:  172 IAHLCLSHVH-PSILHNVCHSWRRLIYSPSFPPFLSLYALFSPKSNSS---STPIHLFTFDPVSSTW-DXXXXXXXXXXXXXXXXXXSFLSRNLPVQLVSLSGKLILLAATTHNFNPALTRPLIFDPICRTWTFGPELVTPRRWCAAGCSRGAVYVASGIGSQFSSDVAKSVE 675
            I+ +CLS VH PS+L  VC  WRRL+YSP FP F SLYALF   ++ +   +  +    F+PVSS W                    SF+S NLP+Q VS +GKLIL+A +    +PA++ PLIFDPI  +W+ GP + +PRRWCA G   GA+Y+ASGI SQFSS VAKSVE
Sbjct:   43 ISEICLSLVHRPSLLSAVCTRWRRLLYSPEFPSFPSLYALFVDSTSDTGRVNPSVRFMCFNPVSSKWYPLPPPPPDPPLHRILYRHPSFISFNLPIQCVSAAGKLILIAGSNQQLSPAISHPLIFDPISSSWSSGPRIGSPRRWCATGACDGAIYIASGISSQFSSTVAKSVE 215          
The following BLAST results are available for this feature:
BLAST of EY659080 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
SKI25_ARATH3.290e-3949.13F-box/kelch-repeat protein SKIP25 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B10-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659080 ID=EY659080|Name=EY659080|organism=Citrus sinensis|type=EST|length=820bp
CCACGCGTCCGCTTTCCCCTTGCCATGTCCAAATACCGGCTCACCATTTC
TTCTAAACGCCAAAAACTAACACAAACACTGACCACGCAACCTCTAGCTC
AGGATCAAGATAAAGCTCAAGACGATGATGGTGATGATCATCAGCCACTG
CTTCCGGGCTTACCCGATCACATAGCTCACCTCTGCCTCTCCCACGTCCA
CCCATCAATCCTCCACAACGTCTGCCACTCCTGGCGTCGCCTCATTTACT
CCCCTTCTTTCCCTCCTTTCCTCTCCCTGTACGCCCTCTTCTCTCCTAAA
TCGAACTCTTCTTCTACTCCAATCCATTTATTCACTTTCGATCCCGTCTC
CTCTACCTGGGACCCGCTCCCTCGTCCGCCCCCGGACCCGCCTCTCCACC
TCATTCTCCACCACCCTTCTTTCCTCTCCCGCAACCTCCCCGTCCAGTTA
GTCTCCCTCTCCGGCAAGCTCATCCTCCTCGCCGCCACCACCCACAACTT
CAACCCGGCGCTGACCCGCCCTCTCATCTTCGACCCCATTTGCCGGACCT
GGACGTTCGGCCCCGAGCTCGTCACCCCGCGCCGGTGGTGCGCGGCGGGG
TGCTCTCGTGGCGCGGTGTATGTTGCCAGCGGGATCGGATCCCAGTTCTC
TAGCGACGTGGCGAAGTCCGTGGAGAATGGGACTTGATGAACGGGAAAAA
ACTNCGAGTGGGAGAAGACGGGGAGCTGAAAGACGGAGGTCAGCAGGGAG
CGATAACCCGNNGGGGTGGAAGGGAGCTGTGCTTGTCATGTGAAGGCGCT
GAAGTGCGTCTACACGTCNT
back to top