EY659076

Overview
NameEY659076
Unique NameEY659076
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length461
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13 contig Csv1_Contig13:1214..1674. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659076 vs. ExPASy Swiss-Prot
Match: PFPA_RICCO (Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha OS=Ricinus communis GN=PFP-ALPHA PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 6.418e-39
Identity = 76/93 (81.72%), Postives = 88/93 (94.62%), Query Frame = 3
Query:   12 KAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRDYMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAMSAS 290
            KAYELLR NA +FL+DDLYRNPGP+QF+GPGADAK +TLCVED+DYMGRIK+LQ+YLD+VRTIVKPGCSQEVLKAALSVMASVT+VL  MS++
Sbjct:  517 KAYELLRLNAVKFLMDDLYRNPGPLQFEGPGADAKPITLCVEDQDYMGRIKKLQEYLDKVRTIVKPGCSQEVLKAALSVMASVTDVLLTMSST 609          
BLAST of EY659076 vs. ExPASy Swiss-Prot
Match: PFPA_SOLTU (Pyrophosphate--fructose 6-phosphate 1-phosphotransferase subunit alpha OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.283e-36
Identity = 73/100 (73.00%), Postives = 88/100 (88.00%), Query Frame = 3
Query:    6 RPKAYELLRQNATRFLLDDLYRNPGPVQFDGPGADAKAVTLCVEDRDYMGRIKELQKYLDEVRTIVKPGCSQEVLKAALSVMASVTEVLSAMSASGGQTT 305
            R K+YELL QNAT+FLLDD+YRNPGP+QFDGPGADAKA +L VED DY+G IK+LQ+YLD+VRTIVKPGCSQ+VLKAALS MASVT++LS +S+    +T
Sbjct:  515 RGKSYELLSQNATKFLLDDVYRNPGPLQFDGPGADAKAGSLVVEDADYIGAIKKLQEYLDKVRTIVKPGCSQDVLKAALSAMASVTDILSVISSPSSVST 614          
The following BLAST results are available for this feature:
BLAST of EY659076 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PFPA_RICCO6.418e-3981.72Pyrophosphate--fructose 6-phosphate 1-phosphotrans... [more]
PFPA_SOLTU2.283e-3673.00Pyrophosphate--fructose 6-phosphate 1-phosphotrans... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659076 ID=EY659076|Name=EY659076|organism=Citrus sinensis|type=EST|length=461bp
CCACGCGTCCGAAAGCTTATGAGCTCTTGAGACAAAATGCAACAAGATTC
TTGTTGGACGACCTCTACAGAAATCCTGGACCCGTTCAGTTTGATGGTCC
TGGTGCAGATGCTAAGGCTGTAACTCTGTGTGTTGAAGACCGGGATTACA
TGGGCCGTATTAAGGAACTGCAGAAGTATCTAGACGAGGTTCGAACCATA
GTGAAACCAGGTTGTTCACAAGAGGTACTGAAAGCAGCTTTGAGTGTTAT
GGCTTCTGTGACGGAAGTTCTCTCAGCAATGTCTGCATCTGGAGGCCAGA
CAACACTTTAAGACGAAGTTGGCTGATTATGCTTTGCTTTCTTCTTTAAG
ACAACTTAGCTGATTATGCTTGCTTTCTTCTTCTTTTGCCAAGCCATTTA
CTGTGTATTGGTAGTAATGAATTGAGTTCATTCTCTTTTGTTATTCAAAA
AAAAAAAAAAA
back to top