EY659075

Overview
NameEY659075
Unique NameEY659075
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length933
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: GME2_ORYSJ (GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp. japonica GN=GME-2 PE=2 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 4.347e-102
Identity = 176/188 (93.62%), Postives = 185/188 (98.40%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKD 576
            KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTD+FEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFE+K+LPIHHIPGPEGVRGRNSDNTLIKEKLGWAP+M+LKDGLRITYFWIKEQ+EKEK +G+DLS YGSSKVV TQAPVQLGSLRAADGK+
Sbjct:  184 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFENKQLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMRLKDGLRITYFWIKEQLEKEKAEGVDLSAYGSSKVVQTQAPVQLGSLRAADGKE 371          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: GME1_ORYSJ (GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. japonica GN=GME-1 PE=1 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 7.415e-102
Identity = 175/188 (93.09%), Postives = 184/188 (97.87%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKD 576
            KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKA TSTD+FEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEI+LSFED++LPIHHIPGPEGVRGRNSDNTLIKEKLGWAP+MKLKDGLR TYFWIKEQIEKEKTQG+D++ YGSSKVV TQAPVQLGSLRAADGK+
Sbjct:  191 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRELPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMKLKDGLRFTYFWIKEQIEKEKTQGVDIAGYGSSKVVSTQAPVQLGSLRAADGKE 378          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: GME1_ORYSI (GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. indica GN=OsI_032456 PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 7.415e-102
Identity = 175/188 (93.09%), Postives = 184/188 (97.87%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKD 576
            KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKA TSTD+FEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEI+LSFED++LPIHHIPGPEGVRGRNSDNTLIKEKLGWAP+MKLKDGLR TYFWIKEQIEKEKTQG+D++ YGSSKVV TQAPVQLGSLRAADGK+
Sbjct:  191 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIILSFEDRELPIHHIPGPEGVRGRNSDNTLIKEKLGWAPTMKLKDGLRFTYFWIKEQIEKEKTQGVDIAGYGSSKVVSTQAPVQLGSLRAADGKE 378          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: GME_ARATH (GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana GN=At5g28840 PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.071e-100
Identity = 173/188 (92.02%), Postives = 184/188 (97.87%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIPGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKEKTQGIDLSVYGSSKVVGTQAPVQLGSLRAADGKD 576
            KDFGIECR+GRFHNIYGPFGTWKGGREKAPAAFCRKA TSTD+FEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAE+VLSFE+KKLPIHHIPGPEGVRGRNSDN LIKEKLGWAP+M+LK+GLRITYFWIKEQIEKEK +G D+S+YGSSKVVGTQAPVQLGSLRAADGK+
Sbjct:  190 KDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFCRKAQTSTDRFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEMVLSFEEKKLPIHHIPGPEGVRGRNSDNNLIKEKLGWAPNMRLKEGLRITYFWIKEQIEKEKAKGSDVSLYGSSKVVGTQAPVQLGSLRAADGKE 377          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: UXS1_DANRE (UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.214e-11
Identity = 45/155 (29.03%), Postives = 77/155 (49.68%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHIP-GPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIEKE 474
            K  G+E RV R  N +G       GR    + F  +AL   +   ++G G QTR+F ++ + V G++ L  S+   PVN+G+ E  ++ E A+++ S    +  I  +P   +  + R  D    K  LGW P + L++GL  T  +   ++E +
Sbjct:  245 KQEGVEVRVARIFNTFGSRMHMNDGR--VVSNFILQALQG-EALTVYGSGSQTRAFQYVSDLVNGLVSLMNSNISSPVNLGNPEEHTILEFAQLIKSLVASRSHIQFLPEAQDDPQRRRPDIRKAKLLLGWEPVVPLEEGLNKTIQYFSRELEHQ 396          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: UXS1_RAT (UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.027e-11
Identity = 43/153 (28.10%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHI-PGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIE 468
            K  G+E RV R  N +GP      GR    + F  +AL   +   ++G G QTR+F ++ + V G++ L  S+   PVN+G+ E  ++ E A+++ +       I  +    +  + R  D    K  LGW P + L++GL     + ++++E
Sbjct:  247 KQEGVEVRVARIFNTFGPRMHMNDGR--VVSNFILQALQG-EPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELE 396          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: UXS1_PONAB (UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.027e-11
Identity = 43/153 (28.10%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHI-PGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIE 468
            K  G+E RV R  N +GP      GR    + F  +AL   +   ++G G QTR+F ++ + V G++ L  S+   PVN+G+ E  ++ E A+++ +       I  +    +  + R  D    K  LGW P + L++GL     + ++++E
Sbjct:  247 KQEGVEVRVARIFNTFGPRMHMNDGR--VVSNFILQALQG-EPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELE 396          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: UXS1_MOUSE (UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.027e-11
Identity = 43/153 (28.10%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHI-PGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIE 468
            K  G+E RV R  N +GP      GR    + F  +AL   +   ++G G QTR+F ++ + V G++ L  S+   PVN+G+ E  ++ E A+++ +       I  +    +  + R  D    K  LGW P + L++GL     + ++++E
Sbjct:  247 KQEGVEVRVARIFNTFGPRMHMNDGR--VVSNFILQALQG-EPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELE 396          
BLAST of EY659075 vs. ExPASy Swiss-Prot
Match: UXS1_HUMAN (UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.027e-11
Identity = 43/153 (28.10%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   13 KDFGIECRVGRFHNIYGPFGTWKGGREKAPAAFCRKALTSTDKFEMWGDGLQTRSFTFIDECVEGVLRLTKSDFREPVNIGSDEMVSMNEMAEIVLSFEDKKLPIHHI-PGPEGVRGRNSDNTLIKEKLGWAPSMKLKDGLRITYFWIKEQIE 468
            K  G+E RV R  N +GP      GR    + F  +AL   +   ++G G QTR+F ++ + V G++ L  S+   PVN+G+ E  ++ E A+++ +       I  +    +  + R  D    K  LGW P + L++GL     + ++++E
Sbjct:  247 KQEGVEVRVARIFNTFGPRMHMNDGR--VVSNFILQALQG-EPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELE 396          
The following BLAST results are available for this feature:
BLAST of EY659075 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
GME2_ORYSJ4.347e-10293.62GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp.... [more]
GME1_ORYSJ7.415e-10293.09GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp.... [more]
GME1_ORYSI7.415e-10293.09GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp.... [more]
GME_ARATH1.071e-10092.02GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana ... [more]
UXS1_DANRE1.214e-1129.03UDP-glucuronic acid decarboxylase 1 OS=Danio rerio... [more]
UXS1_RAT6.027e-1128.10UDP-glucuronic acid decarboxylase 1 OS=Rattus norv... [more]
UXS1_PONAB6.027e-1128.10UDP-glucuronic acid decarboxylase 1 OS=Pongo abeli... [more]
UXS1_MOUSE6.027e-1128.10UDP-glucuronic acid decarboxylase 1 OS=Mus musculu... [more]
UXS1_HUMAN6.027e-1128.10UDP-glucuronic acid decarboxylase 1 OS=Homo sapien... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-B03-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659075 ID=EY659075|Name=EY659075|organism=Citrus sinensis|type=EST|length=933bp
CCACGCGTCCGGAAAGACTTTGGAATTGAGTGTCGTGTTGGAAGATTCCA
CAATATTTATGGGCCTTTTGGAACATGGAAAGGTGGAAGGGAAAAAGCTC
CTGCTGCTTTTTGCCGAAAGGCTCTTACTTCAACTGACAAGTTTGAGATG
TGGGGAGATGGACTTCAAACTCGATCTTTCACCTTCATTGATGAATGTGT
TGAAGGTGTGCTCAGATTGACGAAGTCAGACTTCCGTGAGCCAGTGAACA
TTGGTAGTGATGAGATGGTTAGCATGAACGAGATGGCTGAGATTGTTCTT
AGCTTTGAGGACAAGAAGCTACCTATCCACCACATTCCTGGCCCTGAGGG
TGTCCGTGGTCGTAATTCAGACAACACACTGATCAAAGAGAAGCTTGGTT
GGGCACCATCCATGAAGTTGAAGGATGGGCTGAGAATTACGTATTTCTGG
ATCAAGGAACAGATTGAGAAGGAGAAGACTCAAGGTATTGACCTATCTGT
TTATGGATCATCGAAGGTGGTAGGAACTCAAGCACCAGTTCAGTTAGGCT
CACTTCGTGCTGCTGATGGCAAAGATGAAGTGGTTGAGCCATACATCTCT
CGTAGTTGCCCTCAGAAAAGCATGTTTTATTATGCTATTTCTAGCAATCA
TAATTCCATGGTGTCTTTATGATATAAAGCTATCATTATGAGTAAAAATT
TACTTGTGTGGAGATTTANGACGCCTTGAGTTTGAACATTCTTCAAATGG
GTTCTAGNCTGAACTATGCTGAAGTGTCTGGGAAAGCTTTTGCGCTCATT
NGATTTCACCTAGCTTTCAGGGAGGCTGCTCAGTAGGATGAATAGGACAT
TCCCTTTTGGGATTATTGGCGGTTGAATAAAAAAATTCATTTTAAAAAAA
AAAAGGCGGCGGTCTAAGGTCAAGCTTCGACGG
back to top