EY659069

Overview
NameEY659069
Unique NameEY659069
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length621
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659069_ssr458 microsatellite EY659069_ssr458:458..469. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13803 contig Csv1_Contig13803:7..627. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 6.828e-32
Identity = 59/97 (60.82%), Postives = 78/97 (80.41%), Query Frame = 3
Query:  117 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            P+  AITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CGV IPY+ISPST+C+ V+
Sbjct:   22 PIAQAITCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 8.917e-32
Identity = 63/97 (64.95%), Postives = 75/97 (77.32%), Query Frame = 3
Query:  117 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            P T A++CGQV++SLAPCI +L  GG  PP  CCSGV+SLN AA+TTPDRQAAC CLK AY +I G+    AA  P +CGV IPYKISPSTDCS+V+
Sbjct:   21 PYTEALSCGQVSSSLAPCISYLTKGGAVPPA-CCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.165e-31
Identity = 61/96 (63.54%), Postives = 77/96 (80.21%), Query Frame = 3
Query:  120 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            V +AITCGQVT+SLAPCI ++R+GG  PP  CC+G+R++NG ARTT DRQ ACNCLK   G+I G+ PN AAGLP +CGV +PYKIS ST+C+ V+
Sbjct:   21 VAHAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: LTP1_MORNI (Non-specific lipid-transfer protein 1 OS=Morus nigra PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.426e-31
Identity = 62/92 (67.39%), Postives = 75/92 (81.52%), Query Frame = 3
Query:  132 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            ITCGQV++SLAPCI +LR GG   P  CC+GVRSLN AA+TT DRQAACNCLK A+ +I+G+  N+AAGLP +CGV +PYKISPSTDC  V+
Sbjct:    1 ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIKGLNLNLAAGLPGKCGVSVPYKISPSTDCKSVK 91          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUPE (Non-specific lipid-transfer protein 1 OS=Prunus persica PE=1 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.090e-29
Identity = 57/92 (61.96%), Postives = 74/92 (80.43%), Query Frame = 3
Query:  132 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            ITCGQV+++LAPCIP++R GG  PP  CC+G+R++N  ARTTPDRQAACNCLK+   ++ G+ PN AA LP +CGV IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSALAPCIPYVRGGGAVPPA-CCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK 91          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.142e-29
Identity = 55/96 (57.29%), Postives = 75/96 (78.12%), Query Frame = 3
Query:  120 VTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            V +AITC QV+A+LAPCI ++R+GG  PP  CC+G++++NG A+TTPDRQAACNCLK   G++ G+ P  A  LP +CGV +PYKIS ST+C+ V+
Sbjct:   21 VAHAITCSQVSANLAPCINYVRSGGAVPPA-CCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 5.410e-29
Identity = 57/92 (61.96%), Postives = 73/92 (79.35%), Query Frame = 3
Query:  132 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            ITCGQV++SLAPCI ++R GG  PP  CC+G+R++N  ARTTPDR+ ACNCLK+  G+I G+ PN AA LP +CGV IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPA-CCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.056e-28
Identity = 53/97 (54.64%), Postives = 74/97 (76.29%), Query Frame = 3
Query:  117 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            P+  A+TCGQV+++LAPCI ++R GG  PP  CC+G+R++N  A+TT DRQ ACNCLK+   ++ G+  N AA LP +CGV +PYKISPST+C+ V+
Sbjct:   22 PIAQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP1_TOBAC (Non-specific lipid-transfer protein 1 OS=Nicotiana tabacum GN=LTP1 PE=1 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 5.981e-28
Identity = 61/97 (62.89%), Postives = 70/97 (72.16%), Query Frame = 3
Query:  117 PVTNAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            P   AITCGQVT++LAPC+ +LR  G  P   CC GV++L  +ARTT DRQ AC CLK A G I GI    AAGLPS CGV IPYKISPSTDCS+V+
Sbjct:   20 PCAEAITCGQVTSNLAPCLAYLRNTG--PLGRCCGGVKALVNSARTTEDRQIACTCLKSAAGAISGINLGKAAGLPSTCGVNIPYKISPSTDCSKVQ 114          
BLAST of EY659069 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDO (Non-specific lipid-transfer protein 1 OS=Prunus domestica PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.333e-27
Identity = 54/92 (58.70%), Postives = 73/92 (79.35%), Query Frame = 3
Query:  132 ITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGTIRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRVR 407
            ITCGQV+++LAPCI +++ GG  PP  CC+G+R++N  ARTT DR+AACNCLK+  G+I G+ PN AA LP +CGV +PYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSNLAPCINYVKGGGAVPPA-CCNGIRNVNNLARTTADRRAACNCLKQLSGSIPGVNPNNAAALPGKCGVNVPYKISASTNCATVK 91          
The following BLAST results are available for this feature:
BLAST of EY659069 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 80
Match NameE-valueIdentityDescription
NLTP1_PRUDU6.828e-3260.82Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_HELAN8.917e-3264.95Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP_MALDO1.165e-3163.54Non-specific lipid-transfer protein OS=Malus domes... [more]
LTP1_MORNI4.426e-3167.39Non-specific lipid-transfer protein 1 OS=Morus nig... [more]
NLTP1_PRUPE1.090e-2961.96Non-specific lipid-transfer protein 1 OS=Prunus pe... [more]
NLTP_PYRCO4.142e-2957.29Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP1_PRUAR5.410e-2961.96Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP_PRUAV2.056e-2854.64Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP1_TOBAC5.981e-2862.89Non-specific lipid-transfer protein 1 OS=Nicotiana... [more]
NLTP1_PRUDO1.333e-2758.70Non-specific lipid-transfer protein 1 OS=Prunus do... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-A09-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659069 ID=EY659069|Name=EY659069|organism=Citrus sinensis|type=EST|length=621bp
CCACGCGTCCGAGAACCTGATAACTAGCTATAACCAAGCAAAAGCCTCCC
TGAAGAATCCTCATGGCTGCTCTTAAGCTTGTTTGTGCTTTGCTTTTGTG
CATTCTGGTGACTGCCCCGGTGACTAATGCCATAACATGCGGGCAGGTGA
CAGCCTCCTTGGCTCCATGCATCCCTTTCTTGAGAACTGGAGGGCGTTTT
CCTCCACCGCCATGCTGTAGCGGCGTCAGGTCTCTCAACGGCGCCGCCAG
AACCACCCCTGACCGCCAAGCTGCATGCAACTGCTTGAAACGAGCTTACG
GAACAATCCGCGGCATCAAACCTAATGTTGCCGCTGGCCTTCCTAGTCAA
TGTGGAGTCAGAATTCCTTACAAGATCAGCCCCAGCACCGACTGCTCTAG
GGTCAGGTGAAGTTGAGTTTGAGCTCTGTGACTTTCCAAGTATGATTGAC
TGAGAAGAATAAATAAATAAAGAATATCTATGTTAATTTCTTTGTCCGAA
CGAGTCTCCACTTGTATGAGTTTCACTCTCATGTCATGTTTGTATATTTG
CTTTTTATGTCATATTAAATATGTAAACGCGATCTGTGTTTTGAGTGATT
AAAAAAAAAAAAAAAAAAAAA
back to top