EY659068

Overview
NameEY659068
Unique NameEY659068
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY659068_ssr273 microsatellite EY659068_ssr273:273..284. BLAST: Citrus ESTs to Prunus persica proteins V1
EY659068_ssr878 microsatellite EY659068_ssr878:878..889. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7453 contig Csv1_Contig7453:1..916. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_OCIBA (Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 6.566e-74
Identity = 125/212 (58.96%), Postives = 158/212 (74.53%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVD 637
            +A +   L T  DG V  +YGLA VC++L  NEDGVS+AP+ L+ Q+KV ++ WYHL D +++G +PF KA+     FEY   D R   +FNQ M NH+ + MKKILE Y GF+ +  +VDV GG GA L+++VSKYP I+GINFD PHVI+DAPSY GVEHVGGDMFV VPKG+AIF+KWI HDWSD+ CVK LKNCYDALP+ GKVI+ +
Sbjct:   85 YAILECRLKTLPDGGVERLYGLAPVCKFLTKNEDGVSMAPLTLMNQDKVLMESWYHLSDAVVDGGIPFNKAYGM-TAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYDALPQNGKVILAE 295          

HSP 2 Score: 32.3426 bits (72), Expect = 6.566e-74
Identity = 16/40 (40.00%), Postives = 25/40 (62.50%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +PE+ +T + ++ V  +D+ M    PGGKERT  E + LA
Sbjct:  298 LPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQGLA 337          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT2_OCIBA (Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.900e-73
Identity = 124/212 (58.49%), Postives = 157/212 (74.06%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVD 637
            +A +   L T  DG V  +YGLA VC++L  NEDGVS+AP+ L+ Q+KV ++ WYHLKD +L+G +PF KA+     FEY   D R   +FNQ M NH+ + MKKILE Y GF+ +  +VDV GG GA L++++SKYP I+GINFD PHV++DAPSY GVEHVGGDMFV VPKG+AIF+KWI HDWSD  CVK LK CY+ALPE GKVI+ +
Sbjct:   85 YAILECRLKTLPDGGVQRLYGLAPVCKFLTKNEDGVSMAPLALMNQDKVLMESWYHLKDAVLDGGIPFNKAYGM-TAFEYHGTDPRFNKVFNQGMSNHSTITMKKILETYTGFDGLKTVVDVGGGTGATLNMIISKYPSIKGINFDLPHVVEDAPSYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDAHCVKFLKKCYEALPENGKVILAE 295          

HSP 2 Score: 32.3426 bits (72), Expect = 1.900e-73
Identity = 16/40 (40.00%), Postives = 25/40 (62.50%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +PE+ +T + ++ V  +D+ M    PGGKERT  E + LA
Sbjct:  298 LPEAPDTGLATKNVVHIDVIMLAHNPGGKERTEKEFQVLA 337          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_PRUDU (Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 2.478e-73
Identity = 124/210 (59.05%), Postives = 159/210 (75.71%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIV 631
            ++ +TY+L T  DG V  +YGL  VC++L  NE+GVS+AP+ L+ Q+KV ++ WYHLKD +LEG +PF KA+     FEY   D R   +FN+ M +H+ + MKKILE YKGFE +  +VDV GG GA L+++VSKYP I+GINFD PHVI+DAP Y GVEHVGGDMFV VPKG+AIF+KWI HDWSD+ C+K LKNCY ALP+ GKVI+
Sbjct:   87 YSILTYSLRTLADGKVERLYGLGPVCKFLTKNEEGVSIAPLCLMNQDKVLLESWYHLKDAVLEGGIPFNKAYGM-TAFEYHGTDPRFNKVFNRGMADHSTITMKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSIKGINFDLPHVIEDAPQYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIL 295          

HSP 2 Score: 31.9574 bits (71), Expect = 2.478e-73
Identity = 16/44 (36.36%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  631 GRLFIPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            G   +P + ++ + ++ V  +D+ M    PGGKERT  E +ALA
Sbjct:  296 GECILPVAPDSSLATKGVVHIDVIMLAHNPGGKERTEQEFQALA 339          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_COFCA (Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 2.478e-73
Identity = 119/200 (59.50%), Postives = 154/200 (77.00%), Query Frame = 2
Query:   38 DGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVD 637
            DG V  +YGLA VC++L  N DGVS+AP+ L+ Q+KV ++ WYHLKD +L+G +PF KA+     FEY   D R   +FNQ M NH+ + MKKILE+Y+GFE +  +VDV GG GA L++++SKYP I+GINF+ PHV++DAPS+ GVEHVGGDMFV VPKG+AIF+KWI HDWSDD C K+LKNCY ALP+ GKVI+ +
Sbjct:   86 DGGVERLYGLAPVCKFLTKNADGVSMAPLLLMNQDKVLMESWYHLKDAVLDGGIPFNKAYGM-TAFEYHGTDPRFNKVFNQGMSNHSTITMKKILEVYRGFEGLKTVVDVGGGTGATLNMIISKYPTIKGINFELPHVVEDAPSHSGVEHVGGDMFVSVPKGDAIFMKWICHDWSDDHCRKLLKNCYQALPDNGKVILAE 284          

HSP 2 Score: 33.8834 bits (76), Expect = 2.478e-73
Identity = 17/40 (42.50%), Postives = 26/40 (65.00%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +PE+ +T + ++ V  +D+ M    PGGKERT  E +ALA
Sbjct:  287 LPEAPDTSLATQNVVHVDVVMLAHNPGGKERTEKEFEALA 326          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_CATRO (Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.219e-72
Identity = 122/202 (60.40%), Postives = 156/202 (77.23%), Query Frame = 2
Query:   38 DGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVDSL 643
            DG +  +Y LA VC++L  NEDGVS+A + L+ Q+KV ++ WYHLKD +LEG +PF KA+     FEY  KD R   +FNQ M NH+ ++MKKILEIY+GF+ +  +VDV GG GA L+++VSKYP I+GINFD PHVI+DAPSY GV+HVGGDMFV VPKG+AIF+KWI HDWSD  C+K LKNC++ALPE GKVI+ + L
Sbjct:   99 DGGIERLYSLAPVCKFLTKNEDGVSMAALLLMNQDKVLMESWYHLKDAVLEGGIPFNKAYGM-TAFEYHGKDPRFNKVFNQGMSNHSTIIMKKILEIYQGFQGLKTVVDVGGGTGATLNMIVSKYPSIKGINFDLPHVIEDAPSYPGVDHVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCHEALPENGKVILAECL 299          

HSP 2 Score: 29.6462 bits (65), Expect = 1.219e-72
Identity = 15/40 (37.50%), Postives = 25/40 (62.50%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +PE+ ++ + ++    +D+ M    PGGKERT  E +ALA
Sbjct:  300 LPEAPDSTLSTQNTVHVDVIMLAHNPGGKERTEKEFEALA 339          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_ROSCH (Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.590e-72
Identity = 121/210 (57.62%), Postives = 158/210 (75.24%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIV 631
            ++ +TY+L T  DG V  +YGL  VC++L  NEDGVS+A + L+ Q+KV V+ WYHLKD +L+G +PF KA+     F+Y   D R   +FN+ M +H+ + MKKILE YKGFE +  +VDV GG GA ++++VSKYP I+GINFD PHVI+DAP Y GV+HVGGDMFV VPKG+AIF+KWI HDWSD+ C+K LKNCY ALP+ GKVI+
Sbjct:   87 YSILTYSLRTLPDGKVERLYGLGPVCKFLTKNEDGVSIAALCLMNQDKVLVESWYHLKDAVLDGGIPFNKAYGM-TAFDYHGTDPRFNKVFNKGMADHSTITMKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSIKGINFDLPHVIEDAPQYPGVQHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIL 295          

HSP 2 Score: 33.8834 bits (76), Expect = 1.590e-72
Identity = 17/44 (38.64%), Postives = 26/44 (59.09%), Query Frame = 1
Query:  631 GRLFIPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            G   +P + +T + ++ V  +D+ M    PGGKERT  E +ALA
Sbjct:  296 GECILPVAPDTSLATKGVVHIDVVMLAHNPGGKERTEQEFEALA 339          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: OMT1_ARATH (Quercetin 3-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 2.074e-72
Identity = 121/215 (56.28%), Postives = 160/215 (74.42%), Query Frame = 2
Query:   14 TYNLVTNKDGNVCG-----VYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVDSL 643
            +Y+++T  +  + G     +YGL  VC+YL  NEDGVS+A + L+ Q+KV ++ WYHLKD +L+G +PF KA+   + FEY   D R   +FN  M NH+ + MKKILE YKGFE +  LVDV GG+GA L ++VSKYP ++GINFD PHVI+DAPS+ G+EHVGGDMFV VPKG+AIF+KWI HDWSD+ CVK LKNCY++LPE GKVI+ + +
Sbjct:   84 SYSVLTCSNRKLSGDGVERIYGLGPVCKYLTKNEDGVSIAALCLMNQDKVLMESWYHLKDAILDGGIPFNKAYGM-SAFEYHGTDPRFNKVFNNGMSNHSTITMKKILETYKGFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIEDAPSHPGIEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCVKFLKNCYESLPEDGKVILAECI 297          

HSP 2 Score: 31.187 bits (69), Expect = 2.074e-72
Identity = 16/40 (40.00%), Postives = 25/40 (62.50%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +PE+ ++ + ++ V  +D  M    PGGKERT  E +ALA
Sbjct:  298 LPETPDSSLSTKQVVHVDCIMLAHNPGGKERTEKEFEALA 337          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_CLABR (Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.704e-72
Identity = 125/214 (58.41%), Postives = 160/214 (74.77%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVDSL 643
            ++ VT +L    DG V  +YGLA VC++L  NEDGVSLAP+ L+ Q+KV ++ WY+LKD +L+G +PF KA+     FEY   D R   +FN+ M +H+ + MKKI E+Y GFE +N +VDV GG GA LS++V+KYP I+GINFD PHVI+DAP Y GVEHVGGDMFV VPKG+AIF+KWI HDWSD+ C+K LKNCY ALPE GKVIV + +
Sbjct:   92 YSVVTCSLRELPDGKVERLYGLAPVCKFLTKNEDGVSLAPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYGM-TAFEYHGTDPRFNKVFNRGMSDHSTITMKKIFEMYTGFEALNTIVDVGGGTGAVLSMIVAKYPSIKGINFDLPHVIEDAPIYPGVEHVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPEHGKVIVAECI 304          

HSP 2 Score: 29.261 bits (64), Expect = 2.704e-72
Identity = 16/40 (40.00%), Postives = 23/40 (57.50%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +P S +  + ++ V  +D  M    PGGKERT  E +ALA
Sbjct:  305 LPLSPDPSLATKGVIHIDAIMLAHNPGGKERTEKEFEALA 344          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_POPTM (Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 1.735e-71
Identity = 123/214 (57.48%), Postives = 160/214 (74.77%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVDSL 643
            ++ +T +L    DG V  +YGLA VC++L  NEDGVS++P+ L+ Q+KV ++ WY+LKD +L+G +PF KA+     FEY   D R   +FN+ M +H+ + MKKILE YKGFE +  LVDV GG GA ++ +VSKYP I+GINFD PHVI+DAPSY GVEHVGGDMFV VPK +A+F+KWI HDWSD  C+K LKNCYDALPE GKVI+V+ +
Sbjct:   87 YSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILDGGIPFNKAYGM-TAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECI 299          

HSP 2 Score: 29.6462 bits (65), Expect = 1.735e-71
Identity = 15/40 (37.50%), Postives = 24/40 (60.00%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +P + +T + ++ V  +D+ M    PGGKERT  E + LA
Sbjct:  300 LPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLA 339          
BLAST of EY659068 vs. ExPASy Swiss-Prot
Match: COMT1_POPKI (Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.951e-71
Identity = 123/214 (57.48%), Postives = 159/214 (74.30%), Query Frame = 2
Query:    2 HASVTYNLVTNKDGNVCGVYGLASVCRYLLPNEDGVSLAPIFLLAQEKVSVDPWYHLKDCLLEGTLPFMKAHNAKNPFEYAMKDARRRNLFNQSMRNHTALVMKKILEIYKGFEEINQLVDVAGGLGANLSLLVSKYPQIRGINFDSPHVIKDAPSYQGVEHVGGDMFVEVPKGEAIFLKWILHDWSDDQCVKILKNCYDALPEFGKVIVVDSL 643
            ++ +T +L    DG V  +YGLA VC++L  NEDGVS++P+ L+ Q+KV ++ WY+LKD +LEG +PF KA+     FEY   D R   +FN+ M +H+ + MKKILE YKGFE +  LVDV GG GA ++ +VSKYP I+GINFD PHVI+DAPSY GVEHVGGDMFV VP  +A+F+KWI HDWSD  C+K LKNCYDALPE GKVI+V+ +
Sbjct:   87 YSILTCSLKDLPDGKVERLYGLAPVCKFLTKNEDGVSVSPLCLMNQDKVLMESWYYLKDAILEGGIPFNKAYGM-TAFEYHGTDPRFNKVFNKGMSDHSTITMKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPSYPGVEHVGGDMFVSVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECI 299          

HSP 2 Score: 29.6462 bits (65), Expect = 2.951e-71
Identity = 15/40 (37.50%), Postives = 24/40 (60.00%), Query Frame = 1
Query:  643 IPESLETDILSRFVYLLDMQMTPVFPGGKERTVXELKALA 762
            +P + +T + ++ V  +D+ M    PGGKERT  E + LA
Sbjct:  300 LPVAPDTSLATKGVVHVDVIMLAHNPGGKERTEKEFEGLA 339          
The following BLAST results are available for this feature:
BLAST of EY659068 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
COMT1_OCIBA6.566e-7458.96Caffeic acid 3-O-methyltransferase 1 OS=Ocimum bas... [more]
COMT2_OCIBA1.900e-7358.49Caffeic acid 3-O-methyltransferase 2 OS=Ocimum bas... [more]
COMT1_PRUDU2.478e-7359.05Caffeic acid 3-O-methyltransferase OS=Prunus dulci... [more]
COMT1_COFCA2.478e-7359.50Caffeic acid 3-O-methyltransferase OS=Coffea canep... [more]
COMT1_CATRO1.219e-7260.40Caffeic acid 3-O-methyltransferase OS=Catharanthus... [more]
COMT1_ROSCH1.590e-7257.62Caffeic acid 3-O-methyltransferase OS=Rosa chinens... [more]
OMT1_ARATH2.074e-7256.28Quercetin 3-O-methyltransferase 1 OS=Arabidopsis t... [more]
COMT1_CLABR2.704e-7258.41Caffeic acid 3-O-methyltransferase OS=Clarkia brew... [more]
COMT1_POPTM1.735e-7157.48Caffeic acid 3-O-methyltransferase 1 OS=Populus tr... [more]
COMT1_POPKI2.951e-7157.48Caffeic acid 3-O-methyltransferase 1 OS=Populus ki... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-A08-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659068 ID=EY659068|Name=EY659068|organism=Citrus sinensis|type=EST|length=913bp
CCACGCGTCCGTAACATATAATCTTGTCACAAATAAAGATGGAAATGTTT
GCGGAGTATATGGTTTAGCGTCCGTTTGCAGATATTTGCTTCCAAATGAA
GACGGAGTTTCTCTTGCTCCCATTTTCCTCTTAGCTCAGGAGAAAGTTTC
TGTAGATCCTTGGTACCACTTGAAAGATTGTTTATTGGAAGGGACCCTAC
CTTTTATGAAGGCACATAATGCAAAAAATCCATTTGAGTATGCTATGAAA
GATGCTAGAAGACGGAACCTCTTCAATCAATCAATGCGCAATCATACAGC
TTTAGTTATGAAGAAAATTCTTGAAATCTACAAAGGATTTGAAGAGATAA
ACCAATTGGTAGATGTTGCCGGTGGTTTAGGTGCTAATCTCAGCTTACTA
GTTTCTAAATACCCACAAATTCGGGGCATTAACTTTGACTCGCCTCATGT
CATTAAAGATGCACCTTCTTATCAAGGTGTGGAGCATGTTGGAGGAGATA
TGTTTGTTGAAGTGCCTAAAGGAGAAGCTATTTTCTTGAAGTGGATACTT
CATGACTGGAGTGATGACCAATGTGTGAAGATACTGAAGAATTGCTACGA
TGCTCTTCCAGAATTCGGGAAGGTCATTGTGGTAGACTCTTTATACCAGA
GTCCCTTGAGACTGATATTTTAAGCAGGTTTGTTTATCTGCTTGACATGC
AAATGACACCTGTATTTCCTGGGGGGAAGGAGAGGACAGTANAGGAGTTG
AAGGCTCTGGCGACAAAGCTGGATTACAGCTGGTAAACTTGTCTGCCGTG
CTTACAGCTGTTGGGTTGTGAACTCAACAATGATCCGAGCTTTGACAGCG
TACAGGTCATTCAAGGTTCTATTTAATTAAATAAATAAAGTGCGACGCCG
TCCTATTATTTTG
back to top