EY659067

Overview
NameEY659067
Unique NameEY659067
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR3B_ARATH (Peptide transporter PTR3-B OS=Arabidopsis thaliana GN=PTR3-B PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 1.661e-66
Identity = 129/277 (46.57%), Postives = 174/277 (62.82%), Query Frame = 3
Query:   15 FERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKP----TCTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDNHQSFMNLIHRLHSKWKTQVLH--SQLSXAGNSCIKHGNGEKQTSC 827
            FERMA+YGI SNLV Y+T++LH+ TV S  NV NW G  W+TP+LGAY+AD + GR+ TF +SS IY+LGM LLT++ SL  +KP    T     C K S  Q+A F+ +LY +AIG GGTKPNIST GADQFD+F+P ++  K SFFNWWMFS F G   AT  LVY+Q+N+GW +GYG+ T GL FS+ IF +G  +Y HK+    SP   + RV +A+    +  +  +   F  L    ++  +   +H  S L     + +K G+  K   C
Sbjct:   43 FERMAYYGISSNLVIYMTTKLHQGTVKSSNNVTNWVGTSWLTPILGAYVADAHFGRYITFVISSAIYLLGMALLTLSVSLPGLKPPKCSTANVENCEKASVIQLAVFFGALYTLAIGTGGTKPNISTIGADQFDEFDPKDKIHKHSFFNWWMFSIFFGTFFATTVLVYVQDNVGWAIGYGLSTLGLAFSIFIFLLGTRLYRHKL-PMGSPFTKMARVIVASLRKAREPMSSDSTRFYELPPMEYASKRAFPIHSTSSLRFLNRASLKTGSTHKWRLC 318          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR3A_ARATH (Peptide transporter PTR3-A OS=Arabidopsis thaliana GN=PTR3-A PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.837e-65
Identity = 131/279 (46.95%), Postives = 171/279 (61.29%), Query Frame = 3
Query:   15 FERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKP----TCTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDNHQ--SFMNLIHRLHSKWKTQVLH--SQLSXAGNSCIKHGNGEKQTSC 827
            FERMA+YGI SNL  Y+T++LH+ TV S  NV NW G  W+TP+LGAY+ D  +GR+ TF +S  IY  GM++LT++ ++  +KP    T     C K S  Q+A F+ +LY +AIG GGTKPNIST GADQFD F+P E+  K+SFFNWWMFS F G L A   LVY+Q+N+GW LGYG+PT GL  S+ IF +G P Y HK+  T SP   + RV +A+F  RK   P  H   SF  L    + +     +H    L     + +K G   K   C
Sbjct:   43 FERMAYYGISSNLFIYMTTKLHQGTVKSSNNVTNWVGTSWLTPILGAYVGDALLGRYITFVISCAIYFSGMMVLTLSVTIPGIKPPECSTTNVENCEKASVLQLAVFFGALYTLAIGTGGTKPNISTIGADQFDVFDPKEKTQKLSFFNWWMFSIFFGTLFANTVLVYVQDNVGWTLGYGLPTLGLAISITIFLLGTPFYRHKL-PTGSPFTKMARVIVASF--RKANAPMTHDITSFHELPSLEYERKGAFPIHPTPSLRFLDRASLKTGTNHKWNLC 318          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR2_ARATH (Peptide transporter PTR2 OS=Arabidopsis thaliana GN=PTR2 PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.010e-55
Identity = 104/228 (45.61%), Postives = 150/228 (65.79%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKPT-CTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDN 698
            ER+A+YGI  NL+ YLT++LH+  VS+  NV  W G  ++TPL+GA +AD Y GR+WT    S IY +GM  LT++AS+  +KP  C    C   + +Q A F+  LY+IA+G GG KP +S+FGADQFDD +  ER  K SFFNW+ FS  IGAL ++  LV+IQEN GWGLG+GIPT  +  ++  F+ G P+Y  + +   SP   + +V +A+F    +++P++
Sbjct:   58 ERLAYYGIAGNLITYLTTKLHQGNVSAATNVTTWQGTCYLTPLIGAVLADAYWGRYWTIACFSGIYFIGMSALTLSASVPALKPAECIGDFCPSATPAQYAMFFGGLYLIALGTGGIKPCVSSFGADQFDDTDSRERVRKASFFNWFYFSINIGALVSSSLLVWIQENRGWGLGFGIPTVFMGLAIASFFFGTPLYRFQ-KPGGSPITRISQVVVASFRKSSVKVPED 284          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR1_ARATH (Peptide transporter PTR1 OS=Arabidopsis thaliana GN=PTR1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.459e-54
Identity = 103/227 (45.37%), Postives = 152/227 (66.96%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKPTCTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDN 698
            ER+A+YG+ +NLVNYL S+L++   ++  NV NWSG  +ITPL+GA+IAD Y+GR+WT      IYV GM LLT++AS+  +KP   N      ++SQ A F+ +LY+IA+G GG KP +S+FGADQFD+ +  E+  K SFFNW+ FS  +GAL A   LV+IQ N+GWG G+G+PT  ++ ++  F+ G   Y  + R   SP   + +V +AAF    +++P++
Sbjct:   41 ERLAYYGMGTNLVNYLESRLNQGNATAANNVTNWSGTCYITPLIGAFIADAYLGRYWTIATFVFIYVSGMTLLTLSASVPGLKPGNCNADTCHPNSSQTAVFFVALYMIALGTGGIKPCVSSFGADQFDENDENEKIKKSSFFNWFYFSINVGALIAATVLVWIQMNVGWGWGFGVPTVAMVIAVCFFFFGSRFYRLQ-RPGGSPLTRIFQVIVAAFRKISVKVPED 266          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR5_ARATH (Peptide transporter PTR5 OS=Arabidopsis thaliana GN=PTR5 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.613e-53
Identity = 98/227 (43.17%), Postives = 154/227 (67.84%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKPTCTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDN 698
            ER+A+YG+ +NL+NYL  Q++ + VS+ ++V+NWSG  + TPL+GA+IAD Y+GR+WT     +IY+ GM LLT++AS+  + PTC+   C  T+  Q A  + +LY+IA+G GG KP +S+FGADQFDD +  E+  K SFFNW+ F   +GA+ A+  LV+IQ N+GWG G G+PT  +  ++V F+ G   Y  + +   SP   +++V +A+    K+++P++
Sbjct:   42 ERLAYYGMSTNLINYLEKQMNMENVSASKSVSNWSGTCYATPLIGAFIADAYLGRYWTIASFVVIYIAGMTLLTISASVPGLTPTCSGETCHATA-GQTAITFIALYLIALGTGGIKPCVSSFGADQFDDTDEKEKESKSSFFNWFYFVINVGAMIASSVLVWIQMNVGWGWGLGVPTVAMAIAVVFFFAGSNFYRLQ-KPGGSPLTRMLQVIVASCRKSKVKIPED 266          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: PTR2X_ARATH (Probable peptide transporter At1g52190 OS=Arabidopsis thaliana GN=At1g52190 PE=1 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 6.791e-44
Identity = 96/251 (38.25%), Postives = 143/251 (56.97%), Query Frame = 3
Query:   12 AFERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMK-----PTCTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDD-FNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDNHQSFMNLIHRLHSKWK 746
            AFE++A YG+  N++ YL              +  WS     TPLLGA+++D+Y+GRF T +++SL   LGM+LL + A L  +K     PT     C  ++ SQ+A  YS+  +I+IG+GG +P    FGADQ D+  NP    +  SFF W+  SS +  L A  G+VYIQE+LGW +G+G+P   +L + ++F +  P+Y  +   TKS    L +  +AA+  RK+ LPD+H SF    H   S+ K
Sbjct:   36 AFEKVASYGLLPNMIMYLIRDYRFGVAKGTNVLFMWSAASNFTPLLGAFLSDSYLGRFLTISIASLSSFLGMVLLWLTAMLPQVKPSPCDPTAAGSHCGSSTASQLALLYSAFALISIGSGGIRPCSLAFGADQLDNKENPKNERVLESFFGWYYASSAVAVLIAFTGIVYIQEHLGWKIGFGVPAVLMLIAALLFILASPLYVTR-GVTKSLFTGLAQAIVAAYKKRKLSLPDHHDSFDCYYHMKDSEIK 285          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: CHL1_ARATH (Nitrate/chlorate transporter OS=Arabidopsis thaliana GN=CHL1 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.340e-36
Identity = 83/231 (35.93%), Postives = 131/231 (56.71%), Query Frame = 3
Query:   12 AFERMAFYGIQSNLVNYLTSQLHEDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKPT----CTNGICSKTSTSQIAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLP 692
            A ER+   GI  NLV YLT  +H    ++   V N+ G  ++  LLG +IADT++GR+ T  + + I   G+ +LT++  +  ++P      T+  C + S  Q+   Y +LY+ A+G GG K ++S FG+DQFD+  P ER+    FFN + F   +G+L A   LVY+Q+++G   GYGI    ++ +L +F  G   Y  K +   SP   +  V +AA+ NRK++LP
Sbjct:   42 AVERLTTLGIGVNLVTYLTGTMHLGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPTTSSHCEQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFDETEPKERSKMTYFFNRFFFCINVGSLLAVTVLVYVQDDVGRKWGYGICAFAIVLALSVFLAGTNRYRFK-KLIGSPMTQVAAVIVAAWRNRKLELP 271          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: S15A4_XENLA (Solute carrier family 15 member 4 OS=Xenopus laevis GN=slc15a4 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.511e-22
Identity = 75/257 (29.18%), Postives = 127/257 (49.42%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLH--EDTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMKPTCTN------GICSKTSTSQ------------IAFFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHKIRKTKSPARDLIRVPIAAFXNRKIQLPDNHQSFMNLIHR 728
            ER+AFYGI SNLV +L  Q+   E T +S + +  + G+ ++      ++AD  +GRF+    S ++Y+LGM+L  M +        C +        CS+++ S                 +  L I+ +G G  K NI+ FGADQ  D  P        FFNW+ +S  +GA+ +  G+ Y+Q+N+ + +GY IP   +  S ++F  GK ++  K     S   D++++ +A F   +    +N ++  N  HR
Sbjct:   44 ERVAFYGITSNLVLFLNGQIFGWEGTQAS-QALLLFMGITYLVSPFAGWLADALLGRFYVILGSMVLYLLGMLLFPMVSYSGTRTAFCGDIQWAQIENCSRSNASSDDTCPEPSRRYCAPALFLGLIIVGLGVGSVKANITPFGADQVKDRGPEATR---RFFNWFYWSINLGAIISLGGVAYVQQNVEFLIGYIIPAVCIGVSFLVFLCGKTVFVTK-PADGSAFTDMVKI-LAYFCCSRKHTRENTRNIQNNQHR 294          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: S15A3_HUMAN (Solute carrier family 15 member 3 OS=Homo sapiens GN=SLC15A3 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 8.932e-20
Identity = 63/213 (29.58%), Postives = 104/213 (48.83%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLHEDT-VSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAA------------SLKFMKPTCTNGICSKTSTSQIA--FFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHK 611
            ER AF+G+ +NLV YL S     T   + R    + G  ++   +G ++AD Y+GR+    LS L+Y+    LL   A                + P C +  C ++S S       Y+ L ++ + A   + N+++FGADQ  D     R+    FFNW+ +S  +GA+ + L + +IQ+N+ + LGY IP   +  +  IF    P++  K
Sbjct:   45 ERAAFFGVTANLVLYLNSTNFNWTGEQATRAALVFLGASYLLAPVGGWLADVYLGRYRAVALSLLLYLAASGLLPATAFPDGRSSFCGEMPASPLGPACPSAGCPRSSPSPYCAPVLYAGLLLLGLAASSVRSNLTSFGADQVMDLG---RDATRRFFNWFYWSINLGAVLSLLVVAFIQQNISFLLGYSIPVGCVGLAFFIFLFATPVFITK 254          
BLAST of EY659067 vs. ExPASy Swiss-Prot
Match: S15A4_BOVIN (Solute carrier family 15 member 4 OS=Bos taurus GN=SLC15A4 PE=2 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.524e-19
Identity = 64/211 (30.33%), Postives = 104/211 (49.29%), Query Frame = 3
Query:   18 ERMAFYGIQSNLVNYLTSQLHE-DTVSSVRNVNNWSGVVWITPLLGAYIADTYIGRFWTFTLSSLIYVLGMILLTMAASLKFMK-------PT----CTNGICSKTSTSQIA-FFYSSLYIIAIGAGGTKPNISTFGADQFDDFNPYERNLKVSFFNWWMFSSFIGALCATLGLVYIQENLGWGLGYGIPTAGLLFSLVIFYIGKPIYXHK 611
            ER AFYG+ +NLV +L       +   + + +  + G+ ++    G ++AD  +GR     LS  +Y+LGM+   + A+            PT    C+   C+ T T   A    S+L ++ +G G  K NI+ FGADQ  D  P        FFNW+ +S  +GA+ +  G+ YIQ+N+ +  GY IP   +  + V+F  G+  +  K
Sbjct:   36 ERAAFYGVTANLVLFLNGTAFGWEGAEASQALLLFMGLTYLVSPFGGWLADARLGRARAILLSLALYLLGMLAFPLLAAPATRSALCGAPGPTNVRNCSAPPCTDTPTRYCAPAVLSALALVGLGVGAVKANITPFGADQVKDRGPEATR---RFFNWFYWSINLGAIVSLGGIAYIQQNVSFVTGYAIPAVCIGVAFVVFLCGQTFFITK 243          
The following BLAST results are available for this feature:
BLAST of EY659067 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
PTR3B_ARATH1.661e-6646.57Peptide transporter PTR3-B OS=Arabidopsis thaliana... [more]
PTR3A_ARATH1.837e-6546.95Peptide transporter PTR3-A OS=Arabidopsis thaliana... [more]
PTR2_ARATH1.010e-5545.61Peptide transporter PTR2 OS=Arabidopsis thaliana G... [more]
PTR1_ARATH1.459e-5445.37Peptide transporter PTR1 OS=Arabidopsis thaliana G... [more]
PTR5_ARATH1.613e-5343.17Peptide transporter PTR5 OS=Arabidopsis thaliana G... [more]
PTR2X_ARATH6.791e-4438.25Probable peptide transporter At1g52190 OS=Arabidop... [more]
CHL1_ARATH2.340e-3635.93Nitrate/chlorate transporter OS=Arabidopsis thalia... [more]
S15A4_XENLA2.511e-2229.18Solute carrier family 15 member 4 OS=Xenopus laevi... [more]
S15A3_HUMAN8.932e-2029.58Solute carrier family 15 member 3 OS=Homo sapiens ... [more]
S15A4_BOVIN1.524e-1930.33Solute carrier family 15 member 4 OS=Bos taurus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-A07-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659067 ID=EY659067|Name=EY659067|organism=Citrus sinensis|type=EST|length=909bp
CCACGCGTCCGGCATTCGAGAGAATGGCCTTCTATGGAATACAATCAAAT
TTAGTGAACTACTTGACAAGCCAACTCCATGAAGACACGGTTTCTTCCGT
CAGAAATGTAAACAACTGGTCAGGTGTTGTGTGGATTACACCACTTCTTG
GTGCCTACATTGCTGATACTTACATTGGTCGTTTTTGGACTTTCACTCTC
TCATCTTTAATTTATGTCCTGGGAATGATACTTCTCACAATGGCAGCTTC
GTTGAAATTTATGAAGCCAACATGCACAAATGGAATCTGCAGCAAGACCT
CTACTTCACAAATTGCTTTCTTTTACTCGTCTCTTTACATCATAGCAATT
GGTGCAGGTGGAACAAAGCCTAACATATCCACTTTTGGTGCAGACCAGTT
CGATGATTTTAATCCCTATGAGAGAAACCTCAAGGTCTCATTCTTTAACT
GGTGGATGTTTAGCTCTTTTATTGGAGCTTTGTGTGCCACTTTAGGGCTT
GTTTACATTCAAGAGAACTTGGGATGGGGATTAGGCTATGGTATTCCAAC
AGCTGGTTTGTTATTTTCCTTAGTCATCTTCTATATAGGAAAGCCCATTT
ACANGCACAAAATTAGGAAGACCAAAAGCCCTGCAAGGGACTTGATTCGA
GTTCCCATAGCTGCTTTCCNGAACCGGAAAATTCAGCTCCCTGACAACCA
TCAGAGCTTCATGAATTTGATACACAGATTACATTCGAAGTGGAAAACGC
AGGTGCTTCACTCTCAGCTTTCANGTGCTGGGAACAGCTGCATAAAACAT
GGCAATGGAGAAAAGCAAACCTCATGCCAGTGACGCAAGAAAAGAACAAA
CTGTTCTAAGGATGCATTGATTGCTAGGACCTAATCCTAGAACATTGGCA
CAATCACCT
back to top