EY659064

Overview
NameEY659064
Unique NameEY659064
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length950
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7452 contig Csv1_Contig7452:1..956. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR3_ARATH (Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=2 SV=2)

HSP 1 Score: 218.394 bits (555), Expect = 4.831e-56
Identity = 92/116 (79.31%), Postives = 109/116 (93.97%), Query Frame = 2
Query:   17 IKPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            +KPEG+DSIP+EIPD KAK+P++WDE+E+GLW+PPKIPN AYKGPW+ KRIKNPNYKGKWK P+IDNPEFEDDPDLYVLK IKY GIEVWQVKAGS++DNILICDDPAYA+ +V++
Sbjct:  240 VKPEGFDSIPREIPDRKAKEPEDWDEEENGLWEPPKIPNSAYKGPWKAKRIKNPNYKGKWKNPWIDNPEFEDDPDLYVLKSIKYAGIEVWQVKAGSIFDNILICDDPAYARSIVDD 355          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_NICPL (Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 3.033e-50
Identity = 81/115 (70.43%), Postives = 99/115 (86.09%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IP+EI DP AKKP++WD++EDG W  P IPNP YKGPW+PK+IKNPNYKGKWK P IDNP+F+DDPDLYV   +KYVG+E+WQVK+G+++DNI+ICDDP YAK + EE
Sbjct:  240 KPEGYDDIPEEITDPDAKKPEDWDDEEDGEWTAPTIPNPEYKGPWKPKKIKNPNYKGKWKAPLIDNPDFKDDPDLYVFPKLKYVGVELWQVKSGTLFDNIVICDDPEYAKAIAEE 354          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_RICCO (Calreticulin OS=Ricinus communis PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 5.173e-50
Identity = 81/115 (70.43%), Postives = 100/115 (86.96%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IPKEIPDP AKKP++WD++EDG W  P I NP YKGPW+PK+IKNPNYKGKWK P IDNP+F+DDP++YV   +KYVGIE+WQVK+G+++DN+LIC+DP YAKQ+ EE
Sbjct:  233 KPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAPTIANPEYKGPWKPKKIKNPNYKGKWKAPMIDNPDFKDDPEIYVYPNLKYVGIELWQVKSGTLFDNVLICNDPEYAKQLAEE 347          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_BERST (Calreticulin OS=Berberis stolonifera PE=2 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.966e-49
Identity = 80/115 (69.57%), Postives = 100/115 (86.96%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IPKEI DP+AKKP++WD++EDG W  P IPNP YKG W+PK+IKNPN+KGKWK P IDNP+F+DDPD+YV   +KYVGIE+WQVK+G+++DN+LICDDP YAK++ EE
Sbjct:  235 KPEGYDDIPKEITDPEAKKPEDWDDEEDGEWTAPTIPNPDYKGEWKPKKIKNPNFKGKWKAPMIDNPDFKDDPDIYVFPKLKYVGIELWQVKSGTMFDNVLICDDPDYAKKLAEE 349          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_BETVU (Calreticulin OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.567e-49
Identity = 79/115 (68.70%), Postives = 99/115 (86.09%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IP EI DP+AKKP++WD++EDG W  P IPNP YKGPW+ K+IKNPNYKGKWK P IDNPEF+DDP+LYV   ++YVG+E+WQVK+G+++DN+L+CDDP YAKQ+ EE
Sbjct:  238 KPEGYDDIPAEITDPEAKKPEDWDDEEDGEWTAPTIPNPEYKGPWKAKKIKNPNYKGKWKAPMIDNPEFKDDPELYVYPKLRYVGVELWQVKSGTLFDNVLVCDDPEYAKQLAEE 352          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_PRUAR (Calreticulin OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 2.839e-48
Identity = 81/115 (70.43%), Postives = 98/115 (85.22%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IPKEI DP AKKP++WD++EDG W  P IPNP YKG W+PK+IKNPN+KGKWK P IDNPEF+DDP+LYV   +KYVGIE+WQVK+G+++DNILI D+P YAKQ+ EE
Sbjct:  237 KPEGYDDIPKEITDPDAKKPEDWDDEEDGEWTAPTIPNPEYKGEWKPKKIKNPNFKGKWKAPLIDNPEFKDDPELYVYPNLKYVGIELWQVKSGTLFDNILITDEPEYAKQLAEE 351          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR2_ARATH (Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=1 SV=3)

HSP 1 Score: 189.504 bits (480), Expect = 2.403e-47
Identity = 76/115 (66.09%), Postives = 98/115 (85.22%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KP+GYD IPKEIPD  +KKP++WD++EDG W  P IPNP Y G W+PK+IKNPNYKGKW+ P IDNP+F+DDP+LYV   +KYVG+E+WQVK+GS++DN+LICDDP YAK++ +E
Sbjct:  235 KPDGYDDIPKEIPDTDSKKPEDWDDEEDGEWTAPTIPNPEYMGEWKPKQIKNPNYKGKWEAPLIDNPDFKDDPELYVFPKLKYVGLELWQVKSGSLFDNVLICDDPDYAKKLADE 349          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR1_ARATH (Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 9.132e-47
Identity = 77/115 (66.96%), Postives = 95/115 (82.61%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KP GYD IPKEIPD  AKKP++WD++EDG W  P IPNP Y G W+PK+IKNP YKGKWK P IDNPEF+DDP+LYV   +KYVG+E+WQVK+GS++DN+L+ DDP YAK++ EE
Sbjct:  235 KPAGYDDIPKEIPDTDAKKPEDWDDEEDGEWTAPTIPNPEYNGEWKPKKIKNPAYKGKWKAPMIDNPEFKDDPELYVFPKLKYVGVELWQVKSGSLFDNVLVSDDPEYAKKLAEE 349          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_MAIZE (Calreticulin OS=Zea mays GN=CRT PE=2 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.193e-46
Identity = 77/115 (66.96%), Postives = 95/115 (82.61%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IPKEIPDP AKKP++WD++EDG W  P IPNP YKGPW+ K+IKNPNY+GKWK P IDNP+F+DDP +Y    +KY+GIE+WQVK+G+++DNI+I DDPA AK   EE
Sbjct:  238 KPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAPTIPNPEYKGPWKQKKIKNPNYQGKWKAPMIDNPDFKDDPYIYAFDSLKYIGIELWQVKSGTLFDNIIITDDPALAKTFAEE 352          
BLAST of EY659064 vs. ExPASy Swiss-Prot
Match: CALR_ORYSJ (Calreticulin OS=Oryza sativa subsp. japonica GN=Os07g0246200 PE=1 SV=2)

HSP 1 Score: 184.496 bits (467), Expect = 7.730e-46
Identity = 76/115 (66.09%), Postives = 93/115 (80.87%), Query Frame = 2
Query:   20 KPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEE 364
            KPEGYD IPKEIPDP AKKP++WD++EDG W  P IPNP YKGPW+ K+IKNPNY+GKWK P IDNP+F+DDP +Y    +KY+GIE+WQVK+G+++DN LI DDP  AK   EE
Sbjct:  242 KPEGYDDIPKEIPDPDAKKPEDWDDEEDGEWTAPTIPNPEYKGPWKQKKIKNPNYQGKWKAPMIDNPDFKDDPYIYAFDSLKYIGIELWQVKSGTLFDNFLITDDPELAKTFAEE 356          
The following BLAST results are available for this feature:
BLAST of EY659064 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
CALR3_ARATH4.831e-5679.31Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=... [more]
CALR_NICPL3.033e-5070.43Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 ... [more]
CALR_RICCO5.173e-5070.43Calreticulin OS=Ricinus communis PE=2 SV=1[more]
CALR_BERST1.966e-4969.57Calreticulin OS=Berberis stolonifera PE=2 SV=1[more]
CALR_BETVU2.567e-4968.70Calreticulin OS=Beta vulgaris PE=2 SV=1[more]
CALR_PRUAR2.839e-4870.43Calreticulin OS=Prunus armeniaca PE=2 SV=1[more]
CALR2_ARATH2.403e-4766.09Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=... [more]
CALR1_ARATH9.132e-4766.96Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=... [more]
CALR_MAIZE1.193e-4666.96Calreticulin OS=Zea mays GN=CRT PE=2 SV=1[more]
CALR_ORYSJ7.730e-4666.09Calreticulin OS=Oryza sativa subsp. japonica GN=Os... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-001-A04-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659064 ID=EY659064|Name=EY659064|organism=Citrus sinensis|type=EST|length=950bp
CCACGCGTCCGATGCCATCAAACCAGAGGGATATGATTCAATTCCAAAAG
AAATTCCGGACCCGAAAGCGAAGAAGCCTGACAATTGGGATGAAGACGAG
GATGGCCTATGGAAACCACCAAAGATACCAAATCCCGCATATAAAGGACC
ATGGAGGCCCAAGAGGATCAAGAACCCAAACTATAAAGGGAAGTGGAAGA
TCCCTTACATTGACAATCCAGAGTTTGAAGATGATCCCGATCTTTACGTG
CTTAAGCCAATTAAGTATGTAGGCATTGAAGTTTGGCAGGTCAAGGCGGG
TTCAGTTTATGACAACATTTTGATCTGTGATGATCCTGCATATGCAAAAC
AAGTGGTCGAGGAAGTACTTTCTAACAGGGAGATTGAAAAAGAGGGTTTT
GAGGAAGCAGAGAAAGTGAGAAAAGCGCGAGAGGAAGAGGAAGCTCAACG
AGCAAGAGAGGAAGGTGAAAAGAGGAGAAGAGAGAGGGGTTATGATCGAA
GAAGATATCGGGATCGCTACAGAGATAAATACCCGAAGCATGATTACTTA
GACGATGATTATCATGATGAGCTATGAAGCAGAGGTCCCTCACTGGTGTT
CCTCACCTGCCCTCCTCAGGGGTGCATCGCCTTTTATGTGAAGGATTGAT
GCTTGCAGCTGCTATAATCAGTAGCATTCGCCCCTGAGTTGTATTTTTGG
CTCTGATTATTGNAGTATTATTTGGAGGCAACACTCCAGCATTTCTAGAT
ACCGAACTAANTGAAGTTTGTTTTTATTGATGGGGCATGCTTTACTTTGA
AGGTAATAAAACACTTTTTTTTTTTAACCAAAAAAAAAAAAAAAAAAAAA
AAAAGGGCGGCGCTCTAAAGATCCAAGTTACGTACCCGGGATGGGACGCA
TAGTCCTCTAAAGGCCCCCAAATCAATCCCTGGCCCGCTTTAAACGCCGG
back to top