DR405971

Overview
NameDR405971
Unique NameDR405971
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length719
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9501 contig Csv1_Contig9501:42..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC2_MOUSE (MOSC domain-containing protein 2, mitochondrial OS=Mus musculus GN=Mosc2 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 8.721e-27
Identity = 76/240 (31.67%), Postives = 118/240 (49.17%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAE---GAEASNWFTNYLGKPS-RLVRYNAESETRPV-----DPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YPIKSC+G+SV +    T  G R     DR WMV+  +G   T R EP+L LV   L N            +++ + APGM+ + + +  P   ++ +      G  +     G E + WFTNYL   + RLV+++   + R          Y    ++ + DC P  L+S+ SL  LN  LK+ + +  FRPNI+V GCE F ED W  + I +   + V  C R
Sbjct:   49 RQLQQVGTVSKVWIYPIKSCKGVSVCE-TECTDMGLRCGKVRDRFWMVVKEDGHMVTARQEPRLVLVSITLEN------------NYLTLEAPGMEQIVLPIKLPS--SNKIHNCRLFGLDIKGRDCGDEVAQWFTNYLKTQAYRLVQFDTSMKGRTTKKLYPSESYLQNYEVAYPDCSPVHLISEASLVDLNTRLKKKVKMEYFRPNIVVSGCEAFEEDTWDELLIGDVEMKRVLSCPR 273          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC2_RAT (MOSC domain-containing protein 2, mitochondrial OS=Rattus norvegicus GN=Mosc2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.328e-26
Identity = 78/243 (32.10%), Postives = 119/243 (48.97%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQ--ALKISLSKPRDIAD----GVSVWEWCGSALAEGAEASNWFTNYLGKPS-RLVRYNAESETRPV-----DPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YPIKSC+G+SV +    T  G R     DR WMV+  +G   T R EP+L LV   L N            +++++ APGM+   L I L     I D    G+ +          G E + WFT+YL   + RLV+++ + + R          Y    ++ + DC P  L+S+ SL  LN  L++ + +  FRPNI+V GCE F ED W  + I +   + V  C R
Sbjct:   49 RQLQQVGTVSKVWIYPIKSCKGVSVCE-TECTDMGLRCGKVRDRFWMVVKEDGHMITARQEPRLVLVTITLEN------------NYLMLEAPGMEPIVLPIKLPSSNKIHDCRLFGLDI-----KGRDCGDEVARWFTSYLKTQAYRLVQFDTKMKGRTTKKLYPSESYLQNYEVAYPDCSPIHLISEASLVDLNTRLQKKVKMEYFRPNIVVSGCEAFEEDTWDELLIGDVEMKRVLSCPR 273          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC2_BOVIN (MOSC domain-containing protein 2, mitochondrial OS=Bos taurus GN=MOSC2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.328e-26
Identity = 79/242 (32.64%), Postives = 120/242 (49.59%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKI-----SLSKPRDI-ADGVSVW-EWCGSALAEGAEASNWFTNYLGKPS-RLVRYNAESETRP---VDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YPIKSC+G+SV   A  T  G R     DR W+VI  +G   T R EP+L LV     ++             +++RAPGM  L +     S +K  D    G+ +    CG       EA+ WFT++L   + RLV++    + R    + P      ++ + DC P M+LS+ SL  LN  +++ + IN FRPNI+V GC  F ED W  + I N   + +  C R
Sbjct:   49 RRLQQVGTVSELWIYPIKSCKGVSVDA-AECTALGLRSGHLRDRFWLVIKEDGHMVTGRQEPQLVLVSITYEDDC------------LILRAPGMDQLVLPTKLLSSNKLHDCRVFGLDIQGRDCGD------EAAQWFTSFLKTDAFRLVQFEKNMKARASNEIFPSLDKNYQVAYPDCSPVMILSEASLADLNTRMEKKVKINNFRPNIVVTGCSAFEEDTWDELLIGNVEMKKILACPR 271          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC1_HUMAN (MOSC domain-containing protein 1, mitochondrial OS=Homo sapiens GN=MOSC1 PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.539e-23
Identity = 74/237 (31.22%), Postives = 113/237 (47.68%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYL-GKPSRLVRYNAESETRPVDPKYAAG-----EKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R ++    V  +++YP+KSC+G+ VS+ A  T  G R     DR W+VIN  G   T R EP+L L+      +        T    + I+ P   A+        +I         CG A A+      W T++L  +P RLV +  E   RP  P   A      ++I +SD  PF++LS+ SL  LN  L++ +    FRPNI++ GC+ ++ED W  + I +   + V  C R
Sbjct:   50 RLLQQVGTVAQLWIYPVKSCKGVPVSE-AECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEG-----RDCGEATAQ------WITSFLKSQPYRLVHF--EPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSR 272          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC1_MOUSE (MOSC domain-containing protein 1, mitochondrial OS=Mus musculus GN=Mosc1 PE=1 SV=2)

HSP 1 Score: 107.071 bits (266), Expect = 9.978e-23
Identity = 70/235 (29.79%), Postives = 113/235 (48.09%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYLGKPS-RLVRYNAE---SETRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YPIKSC+G+SVS +A  T  G R+    DR W+VIN  G   T R EP+L L+     ++        T    + I  P    L         +   V   E  G     G +A+ W +++L   S RLV +        +R +   +   +++ +SD  PF++LS+ SL+ LN  L+  +    FRPNI++ GC  ++ED W  + I +   + V  C R
Sbjct:   53 RRLQQVGTVAQLWIYPIKSCKGLSVS-EAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPL---------LQCRVHGLEIQGRDC--GEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTR 275          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC1_XENLA (MOSC domain-containing protein 1, mitochondrial OS=Xenopus laevis GN=mosc1 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.702e-22
Identity = 67/231 (29.00%), Postives = 109/231 (47.19%), Query Frame = 1
Query:   61 VKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRD--IADGVSVWEWCGSALAEGAEASNWFTNYL--GKPSRLVRYNAE----SETRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            V  + +YP+KSCR + V Q+A  +  G +     DR W+V+   G   T R EP++ L+                    + +  P MQ ++I L  P+   + D   V+         G +AS W   Y    +P RLV + A+     +++  +  +   + I + D  P MLLS+ S++ALN  L++P+ +  FRP I+  GCE F+ED W  +R+     + V  C R
Sbjct:   60 VSQLLIYPVKSCRAVPV-QEAECSALGLKSGHLEDRHWLVVTEEGNMVTARQEPRMVLISATFCGNT------------LCLNGPEMQEVQIPLPLPKSNRVLD-CRVFGQDIQGRDSGEQASEWLATYFQSSQPYRLVHFEADVMRPRQSKKKEKLFRDKDVIAYPDASPIMLLSETSMEALNSRLEQPVSLANFRPCIVASGCEAFAEDDWDDVRLGATRLKRVMACGR 276          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC2_HUMAN (MOSC domain-containing protein 2, mitochondrial OS=Homo sapiens GN=MOSC2 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.903e-22
Identity = 68/236 (28.81%), Postives = 114/236 (48.31%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPR-DIADGVSVWEWCGSALAEGAEASNWFTNYLGKPS-RLVRYNAESE---TRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YP+KSC+G+ VS+ A  T  G R     DR W+VI  +G   T R EP+L L+     N              ++ RAP M  L +   +P  +      ++         G EA+ WFTN+L   + RLV++    +   +R + P      ++ + D  P ++++  SL  LN  +++ + +  FRPNI+V GC+ F ED W  + I +   + V  C R
Sbjct:   49 RRLQQVGTVAKLWIYPVKSCKGVPVSE-AECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLISIIYENNC------------LIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPR 271          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC2_MACFA (MOSC domain-containing protein 2, mitochondrial OS=Macaca fascicularis GN=MOSC2 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.447e-22
Identity = 67/236 (28.39%), Postives = 114/236 (48.31%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPR-DIADGVSVWEWCGSALAEGAEASNWFTNYLG-KPSRLVRYNAESE---TRPVDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            R+++    V  +++YP+KSC+G+ VS+ A  T  G R     DR  +VI  +G   T R EP+L LV     N              ++ +AP M  L +   +P  +      ++         G EA+ WFTN+L  +  RLV++    +   +R + P      ++ + DC P ++++  SL  LN  +++ + +  FRPNI+V GC+ F ED W  + I +   + +  C R
Sbjct:   49 RRLQQVGTVAKLWIYPVKSCKGVPVSE-AECTAMGLRSGNLRDRFLLVIKEDGHIVTARQEPRLVLVSITYENNC------------LIFKAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAQWFTNFLKTEVYRLVQFETNMKGRTSRKLLPTLDQNYQVAYPDCSPLLIMTDASLVDLNTRIEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKIMACPR 271          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOCOS_DANRE (Molybdenum cofactor sulfurase OS=Danio rerio GN=mocos PE=2 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 7.151e-21
Identity = 69/254 (27.17%), Postives = 117/254 (46.06%), Query Frame = 1
Query:   37 RKMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRWDRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIAD-GVSVWEWCGSALAE---GAEASNWFTNYLGKPSRLVRYNAESETRPVDPKYAAGEKIMFSDCYP----------FMLLSQGSLDALNKLLKEPIP-------------INRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            +K  ++  + ++F++P+KSC    V++  PL P G  +DR WMV+N NG   +Q+ EPKL L++  +   A          + + ++  G +A+ + L    + +D   S  + CG  +     G E S W + +LGKP RL+R           P++    K    DC P          F+L+++ S+  L + +                  + RFR N+++   EPF+ED W  + I N  FQ +  C R
Sbjct:  533 KKDGSSCTLTNLFIFPVKSCASFEVTEW-PLGPQGLLYDRLWMVVNENGVCLSQKREPKLCLIQPVVCLAA----------NTLKLQISGSEAITVPLDPSLEKSDLRTSQSKVCGDRVQTVDCGEEVSAWLSEFLGKPCRLIRQR---------PEFLRDMKFGQGDCCPTPLSLVNEAQFLLINRASVCFLQEAIANRYNSDNEETWRDTEQLVQRFRANLVISAQEPFAEDNWSHLTIGNTQFQVIGKCGR 766          
BLAST of DR405971 vs. ExPASy Swiss-Prot
Match: MOSC1_DANRE (MOSC domain-containing protein 1, mitochondrial OS=Danio rerio GN=mosc1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.081e-20
Identity = 70/235 (29.79%), Postives = 111/235 (47.23%), Query Frame = 1
Query:   40 KMEAAAKVKSIFVYPIKSCRGISVSQQAPLTPTGFRW----DRQWMVINNNGRAYTQRNEPKLALVETELPNEAFLEGWEPTGRSFMVIRAPGMQALKISLSKPRDIADGVSVWEWCGSALAEGAEASNWFTNYL--GKPSRLVRYNAESET-RP--VDPKYAAGEKIMFSDCYPFMLLSQGSLDALNKLLKEPIPINRFRPNILVDGCEPFSEDLWMGIRINNCTFQGVKLCDR 717
            K+     V  + V+P+KS + +SV + A     G ++    DR W+VI  +G   T R +P+L LV          EG        + +  P M+ LK  L+   D+     V+         G + S W T +L   KP RLV Y  + +  RP   +P +   +++ + D  P ML+++ S+  LN  L + + + +FRP+I+V  CE F+ED W  IRI     + V  C R
Sbjct:   43 KLTRVGVVTKLLVHPLKSGKAVSV-EAAECLRMGLKYGELRDRHWLVITEDGHMVTGRQQPRLVLVSLTC------EG------GHVSLNGPQMEELKFPLNNSSDLVVDCRVFSVDVQGRDCGDKVSEWLTRFLEADKPVRLVHYEPDLKPQRPHEKEPLFPKDDEVAYPDAAPVMLMTEASVGDLNSRLDKDLSVFQFRPSIVVSDCEAFTEDTWDHIRIGEVELKRVIGCGR 264          
The following BLAST results are available for this feature:
BLAST of DR405971 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
MOSC2_MOUSE8.721e-2731.67MOSC domain-containing protein 2, mitochondrial OS... [more]
MOSC2_RAT4.328e-2632.10MOSC domain-containing protein 2, mitochondrial OS... [more]
MOSC2_BOVIN4.328e-2632.64MOSC domain-containing protein 2, mitochondrial OS... [more]
MOSC1_HUMAN1.539e-2331.22MOSC domain-containing protein 1, mitochondrial OS... [more]
MOSC1_MOUSE9.978e-2329.79MOSC domain-containing protein 1, mitochondrial OS... [more]
MOSC1_XENLA1.702e-2229.00MOSC domain-containing protein 1, mitochondrial OS... [more]
MOSC2_HUMAN2.903e-2228.81MOSC domain-containing protein 2, mitochondrial OS... [more]
MOSC2_MACFA8.447e-2228.39MOSC domain-containing protein 2, mitochondrial OS... [more]
MOCOS_DANRE7.151e-2127.17Molybdenum cofactor sulfurase OS=Danio rerio GN=mo... [more]
MOSC1_DANRE2.081e-2029.79MOSC domain-containing protein 1, mitochondrial OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248F13 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248F13 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405971 ID=DR405971|Name=DR405971|organism=Citrus sinensis|type=EST|length=719bp
GGGGGATCGAGCAAAGGAAAACAGTGTGAGCTACTGAGAAAAATGGAGGC
TGCAGCCAAAGTAAAATCAATATTTGTATACCCAATTAAATCATGCAGAG
GCATCTCTGTCTCTCAGCAGGCACCCCTCACTCCTACTGGATTTCGATGG
GATAGACAGTGGATGGTAATTAATAACAACGGGAGAGCATATACTCAGAG
AAACGAGCCAAAGCTTGCTCTGGTTGAGACAGAGTTGCCAAATGAGGCAT
TTTTAGAAGGATGGGAACCCACTGGGAGATCATTCATGGTAATAAGAGCT
CCAGGGATGCAGGCTCTTAAAATTTCACTGAGCAAACCCCGTGATATAGC
AGACGGTGTTTCCGTATGGGAGTGGTGTGGCTCTGCACTGGCTGAGGGAG
CTGAAGCTTCAAATTGGTTTACAAATTACCTTGGGAAACCTAGTCGGCTA
GTTCGTTACAATGCAGAATCAGAAACTAGACCTGTCGATCCCAAATATGC
TGCTGGAGAGAAAATAATGTTTTCTGATTGTTATCCATTTATGCTGTTGT
CTCAGGGATCTTTAGATGCACTTAATAAGCTTCTCAAGGAGCCTATTCCA
ATCAACCGTTTTCGACCAAACATCCTTGTTGATGGTTGTGAACCGTTTTC
TGAGGACTTATGGATGGGCATCCGAATAAACAATTGCACATTTCAAGGTG
TTAAGCTGTGTGACCGCTG
back to top