DR405970

Overview
NameDR405970
Unique NameDR405970
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length716
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4944 contig Csv1_Contig4944:223..938. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR405970 vs. ExPASy Swiss-Prot
Match: 12KD_FRAAN (Auxin-repressed 12.5 kDa protein OS=Fragaria ananassa PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.207e-28
Identity = 65/121 (53.72%), Postives = 79/121 (65.29%), Query Frame = 2
Query:   59 MLEKLWDDVVAGPQPDRGLGRLRKITTTPLAVKEGGEAESSSGKFQRSLSMXXXXXXXXXXXXXXXXXXXRKDNVWRSVFHPGSNLATRGIGAEVFDKPTHPNSPTVYDWLYSGETRSKHH 421
            +L+KLWDD+VAGPQP+RGLG LRK+   PL +K+ GE+           S                    RKDNVWRSVFHPGSNL+++ +G +VFD P  PNSPTVYDW+YSGETRSKHH
Sbjct:    3 LLDKLWDDIVAGPQPERGLGMLRKVPQ-PLNLKDEGES-----------SKITMPTTPTTPVTPTTPISARKDNVWRSVFHPGSNLSSKTMGNQVFDSP-QPNSPTVYDWMYSGETRSKHH 110          
The following BLAST results are available for this feature:
BLAST of DR405970 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
12KD_FRAAN1.207e-2853.72Auxin-repressed 12.5 kDa protein OS=Fragaria anana... [more]
back to top
Properties
Property NameValue
Genbank descriptionCSAJ-PNP1248F10 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone CSAJ-PNP1248F10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR405970 ID=DR405970|Name=DR405970|organism=Citrus sinensis|type=EST|length=716bp
GGGGACTGAAGAAGAGGTTAAAGATTTAGAAACTAGCAGCTAAATTGTAA
ATTTAAAGATGCTGGAGAAGCTTTGGGACGATGTTGTGGCAGGGCCTCAG
CCTGATCGTGGCCTTGGCAGGCTGAGGAAAATCACCACAACACCCTTAGC
AGTCAAAGAGGGTGGTGAGGCGGAGTCGTCGTCGGGCAAGTTCCAGAGGT
CTCTGTCAATGCCAGCGAGTCCAGGGGCACCGTCGACGCCAGTGACGCCG
ACGACGCCGCTGTCGGCGCGTAAGGACAACGTGTGGAGGAGCGTGTTTCA
CCCCGGTAGCAACCTTGCTACTAGGGGTATCGGTGCAGAGGTCTTTGACA
AGCCCACACATCCTAACTCTCCCACTGTTTATGACTGGCTTTACAGTGGG
GAGACTAGGAGCAAGCATCATCACTAGTGGATGATACGCTACAGCGATGT
AAATGAATGTGATGGGTCACCAACTCACCGGATGAGTTGCCTGTAGTCTG
TAGATAGTGTCGTTTCGTTTTGGATTTCGCAACGTGTCCTTGTCGTCTTG
TTAATGCTATTTGTATTACGTGTCCTTCCTATCTAAAGTTTGGTTTTAAA
ATGCTGCTGACTAAAAGTAAATTAAAGACTGTGATGTTTTTATATCATAT
AATTTAATAATTGTATGTGATGTGAGGATTGCTAAGCTGTGGGCGGAGAT
GAAAGGTTGCTGGTTT
back to top