DR403235

Overview
NameDR403235
Unique NameDR403235
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length388
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DR403235_ssr11 microsatellite DR403235_ssr11:11..26. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2998 contig Csv1_Contig2998:1061..1449. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSJ (Autophagy-related protein 8C OS=Oryza sativa subsp. japonica GN=ATG8C PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.714e-43
Identity = 51/54 (94.44%), Postives = 53/54 (98.15%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKN LPPTAA+MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSAIYEENK 100          

HSP 2 Score: 92.8189 bits (229), Expect = 3.714e-43
Identity = 45/48 (93.75%), Postives = 47/48 (97.92%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA+SSFKLEHPLERRQAE+ RIREKYPDRIPVIVEKAERSDIPDIDKK
Sbjct:    1 MARSSFKLEHPLERRQAEANRIREKYPDRIPVIVEKAERSDIPDIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8C_ORYSI (Autophagy-related protein 8C OS=Oryza sativa subsp. indica GN=ATG8C PE=3 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.714e-43
Identity = 51/54 (94.44%), Postives = 53/54 (98.15%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKN LPPTAA+MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNTLPPTAALMSAIYEENK 100          

HSP 2 Score: 92.8189 bits (229), Expect = 3.714e-43
Identity = 45/48 (93.75%), Postives = 47/48 (97.92%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA+SSFKLEHPLERRQAE+ RIREKYPDRIPVIVEKAERSDIPDIDKK
Sbjct:    1 MARSSFKLEHPLERRQAEANRIREKYPDRIPVIVEKAERSDIPDIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8C_ARATH (Autophagy-related protein 8c OS=Arabidopsis thaliana GN=ATG8C PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.852e-42
Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLSAEKAIF+FVKN LPPTAAMMSAIY+ENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFVFVKNTLPPTAAMMSAIYDENK 100          

HSP 2 Score: 88.9669 bits (219), Expect = 6.852e-42
Identity = 42/48 (87.50%), Postives = 46/48 (95.83%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA SSFKLEHPLERRQ ES+RIREKYPDRIPVIVE+AERSD+P+IDKK
Sbjct:    1 MANSSFKLEHPLERRQIESSRIREKYPDRIPVIVERAERSDVPNIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSJ (Autophagy-related protein 8B OS=Oryza sativa subsp. japonica GN=ATG8B PE=3 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 9.672e-41
Identity = 50/54 (92.59%), Postives = 52/54 (96.30%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLS EKAIFIFVKN LPPTAA+MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENK 100          

HSP 2 Score: 86.6557 bits (213), Expect = 9.672e-41
Identity = 43/48 (89.58%), Postives = 45/48 (93.75%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MAKSSFKL+H LERRQAE+ RIREKY DRIPVIVEKAERSDIPDIDKK
Sbjct:    1 MAKSSFKLDHTLERRQAEANRIREKYSDRIPVIVEKAERSDIPDIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8B_ORYSI (Autophagy-related protein 8B OS=Oryza sativa subsp. indica GN=ATG8B PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.672e-41
Identity = 50/54 (92.59%), Postives = 52/54 (96.30%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLS EKAIFIFVKN LPPTAA+MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNTLPPTAALMSAIYEENK 100          

HSP 2 Score: 86.6557 bits (213), Expect = 9.672e-41
Identity = 43/48 (89.58%), Postives = 45/48 (93.75%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MAKSSFKL+H LERRQAE+ RIREKY DRIPVIVEKAERSDIPDIDKK
Sbjct:    1 MAKSSFKLDHTLERRQAEANRIREKYSDRIPVIVEKAERSDIPDIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8D_ARATH (Autophagy-related protein 8d OS=Arabidopsis thaliana GN=ATG8D PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.781e-40
Identity = 50/54 (92.59%), Postives = 53/54 (98.15%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLS EKAIFIFVKNILPPTAA+MSAIYEE+K
Sbjct:   47 RKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTAAIMSAIYEEHK 100          

HSP 2 Score: 85.5001 bits (210), Expect = 2.781e-40
Identity = 40/48 (83.33%), Postives = 46/48 (95.83%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA SSFK EHPLE+RQAE+ARIREKYPDRIPVIVE+AE+SD+PDID+K
Sbjct:    1 MAISSFKHEHPLEKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSJ (Autophagy-related protein 8A OS=Oryza sativa subsp. japonica GN=ATG8A PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.788e-40
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLS EKAIF+FVKN LPPTA++MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENK 100          

HSP 2 Score: 86.6557 bits (213), Expect = 2.788e-40
Identity = 40/48 (83.33%), Postives = 47/48 (97.92%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA++SFKLEHPLERRQAESARIREKY DRIPVIVEKA+++D+P+IDKK
Sbjct:    1 MARTSFKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPEIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8A_ORYSI (Autophagy-related protein 8A OS=Oryza sativa subsp. indica GN=ATG8A PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.788e-40
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKLS EKAIF+FVKN LPPTA++MSAIYEENK
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENK 100          

HSP 2 Score: 86.6557 bits (213), Expect = 2.788e-40
Identity = 40/48 (83.33%), Postives = 47/48 (97.92%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MA++SFKLEHPLERRQAESARIREKY DRIPVIVEKA+++D+P+IDKK
Sbjct:    1 MARTSFKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPEIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8A_ARATH (Autophagy-related protein 8a OS=Arabidopsis thaliana GN=ATG8A PE=1 SV=2)

HSP 1 Score: 98.5969 bits (244), Expect = 1.919e-38
Identity = 48/54 (88.89%), Postives = 52/54 (96.30%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYVVRKRIKL AEKAIF+FVKN LPPTAA+MSAIYEE+K
Sbjct:   47 KKKYLVPADLTVGQFVYVVRKRIKLGAEKAIFVFVKNTLPPTAALMSAIYEEHK 100          

HSP 2 Score: 80.8777 bits (198), Expect = 1.919e-38
Identity = 38/48 (79.17%), Postives = 44/48 (91.67%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MAKSSFK+ +PLE R +ES+RIREKYPDRIPVIVEKA +SD+PDIDKK
Sbjct:    1 MAKSSFKISNPLEARMSESSRIREKYPDRIPVIVEKAGQSDVPDIDKK 48          
BLAST of DR403235 vs. ExPASy Swiss-Prot
Match: ATG8F_ARATH (Autophagy-related protein 8f OS=Arabidopsis thaliana GN=ATG8F PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 4.244e-38
Identity = 44/54 (81.48%), Postives = 50/54 (92.59%), Query Frame = 2
Query:  227 QKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEENK 388
            +KKYLVPADLTVGQFVYV+RKRIKLSAEKAIFIFV N+LPP  A+MS++YEE K
Sbjct:   47 KKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFVDNVLPPAGALMSSVYEEKK 100          

HSP 2 Score: 84.3445 bits (207), Expect = 4.244e-38
Identity = 41/48 (85.42%), Postives = 45/48 (93.75%), Query Frame = 3
Query:   90 MAKSSFKLEHPLERRQAESARIREKYPDRIPVIVEKAERSDIPDIDKK 233
            MAKSSFK EH LE+R+AE+ARIREKYPDRIPVIVEKAE+SDIP IDKK
Sbjct:    1 MAKSSFKQEHDLEKRRAEAARIREKYPDRIPVIVEKAEKSDIPTIDKK 48          
The following BLAST results are available for this feature:
BLAST of DR403235 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 72
Match NameE-valueIdentityDescription
ATG8C_ORYSJ3.714e-4394.44Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8C_ORYSI3.714e-4394.44Autophagy-related protein 8C OS=Oryza sativa subsp... [more]
ATG8C_ARATH6.852e-4292.59Autophagy-related protein 8c OS=Arabidopsis thalia... [more]
ATG8B_ORYSJ9.672e-4192.59Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8B_ORYSI9.672e-4192.59Autophagy-related protein 8B OS=Oryza sativa subsp... [more]
ATG8D_ARATH2.781e-4092.59Autophagy-related protein 8d OS=Arabidopsis thalia... [more]
ATG8A_ORYSJ2.788e-4088.89Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8A_ORYSI2.788e-4088.89Autophagy-related protein 8A OS=Oryza sativa subsp... [more]
ATG8A_ARATH1.919e-3888.89Autophagy-related protein 8a OS=Arabidopsis thalia... [more]
ATG8F_ARATH4.244e-3881.48Autophagy-related protein 8f OS=Arabidopsis thalia... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244E11 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244E11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403235 ID=DR403235|Name=DR403235|organism=Citrus sinensis|type=EST|length=388bp
GGGGAGTCTTTTTATTTATTTATTTATTTTAATCCGTCGATTCATATTCA
TTTTCCCCTTGGAAGCAGTAGAAAGAACAAGGAGAAGCTATGGCCAAGAG
CTCCTTCAAGCTTGAACACCCACTCGAAAGGAGGCAGGCTGAATCTGCCC
GTATCAGGGAGAAGTATCCTGATAGAATACCAGTGATTGTGGAGAAGGCT
GAAAGGAGTGACATACCTGATATTGACAAAAAAAATACCTGGTTCCTGCT
GATCTGACTGTTGGACAATTTGTTTATGTGGTCCGGAAGAGGATAAAGCT
CAGTGCTGAGAAGGCCATATTCATATTTGTCAAGAACATTTTGCCACCCA
CTGCTGCAATGATGTCTGCAATTTATGAGGAAAACAAA
back to top