DR403185

Overview
NameDR403185
Unique NameDR403185
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length693
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig248 contig Csv1_Contig248:1..676. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BX_ARATH (Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.847e-41
Identity = 79/167 (47.31%), Postives = 113/167 (67.66%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P  S W LS+KYG +M L+ G +P++VVSS++ AK++LK HDL  CSRP+L G + LSYN LD+AFSP+D YW+E+R+ICV  LF   RV++F+PI+EDEV ++I+ +S+S +   P+NLSE   SLT  + C+  FG  +      S   RF  L+++T     SF
Sbjct:   51 PHQSLWRLSKKYGHVMLLKFGSIPTVVVSSSETAKQVLKIHDLHCCSRPSLAGPRALSYNYLDIAFSPFDDYWKELRRICVQELFSVKRVQSFQPIKEDEVKKLIDSVSESASQGTPVNLSEKFTSLTVRVTCKATFGVNFQGTVLNS--DRFEKLIHDTYLFLGSF 215          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BW_ARATH (Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.443e-40
Identity = 74/167 (44.31%), Postives = 116/167 (69.46%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P  + W+LS+KYGP+M L LG VP++VVSS+  A+++L+ HDL  C+RP+L G ++LSYN LD+AFSPYD YW+E+RK+CV  LF + +V + +PI+++EV +MI+ I++S +  NP+NL+     LT +++CR  FG  ++     S   RF+ ++ E   +  SF
Sbjct:   50 PHQTLWKLSKKYGPVMHLMLGRVPTVVVSSSDTARQVLRVHDLHCCTRPSLSGPRELSYNYLDIAFSPYDDYWKEVRKLCVQELFSTKQVHSIQPIKDEEVKKMIDSIAESASQKNPVNLNNKCLELTVSVVCRTAFGVSFEGTVLNS--DRFNKIVREALEMLGSF 214          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BV_ARATH (Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.443e-40
Identity = 75/167 (44.91%), Postives = 115/167 (68.86%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P  S W+LS+KYGP+M L+LG VP+++VSS++ AK+ LK HDL  CSRP   G ++LSYN LD+AFSPYD YW+E+RK+ V  LF S +V + +PI+++EV ++I+ IS+S A   P+NL++ + +LT +++CR  F   ++     S   RF+ ++ E   +  SF
Sbjct:   51 PHQSLWKLSKKYGPVMLLKLGRVPTVIVSSSETAKQALKIHDLHCCSRPGFAGARELSYNYLDIAFSPYDDYWKEVRKLAVQELFSSKQVHSIQPIKDEEVKKLIDSISESAAQKTPINLNKTLLALTVSVVCRTAFSVNFEGTVLNS--ERFNNIVREALEMLGSF 215          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C83B1_ARATH (Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.208e-39
Identity = 80/175 (45.71%), Postives = 118/175 (67.43%), Query Frame = 3
Query:  165 HQFDVSKPQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSFF 689
            HQ +   PQ   + LS+ YGP+ ++++G     V+SSA+LAKE+LKT DL F +RP L GQQ +SY G +L F  Y  Y+RE+RK+C+++LF  NRV +FRP+RE+E  RM++KI K+   S  ++LSE++ S T+ ++CR  FGKRY++    +   RF  +L ETQAL  + F
Sbjct:   43 HQMEKFNPQHFLFRLSKLYGPIFTMKIGGRRLAVISSAELAKELLKTQDLNFTARPLLKGQQTMSYQGRELGFGQYTAYYREMRKMCMVNLFSPNRVASFRPVREEECQRMMDKIYKAADQSGTVDLSELLLSFTNCVVCRQAFGKRYNE--YGTEMKRFIDILYETQALLGTLF 215          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BQ_ARATH (Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=CYP71B26 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.219e-38
Identity = 70/164 (42.68%), Postives = 120/164 (73.17%), Query Frame = 3
Query:  195 SFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            S W+LS+KYGP+M L+LG VP+L++SS++ AK+ L+ +DL  CSRP+L G ++LSYN LD++ SPY+ YW+E+RK+C   LF +N++++ +PI+++EV ++I+ I++S +  NP+NLS+   +LT++++C+  FG  ++     S   RF+ L+ +T  +  SF
Sbjct:   54 SLWKLSKKYGPVMLLKLGKVPTLILSSSETAKQALRDYDLHCCSRPSLAGGRELSYNNLDMSSSPYNEYWKELRKLCSQELFSANKIQSIQPIKDEEVKKVIDSIAESSSLKNPVNLSKTFLALTTSVVCKAAFGVSFEGSVLNS--DRFNKLVRDTFEMLGSF 215          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71B2_ARATH (Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 3.922e-37
Identity = 75/167 (44.91%), Postives = 113/167 (67.66%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P   F +LS KYGPL+ LRLG VP +V+SS++ A+ +LKT+DL+ CSRP  VG  KLSY   D+ F+PY  YWRE+RK+ VI LF S +V++FR IRE+EV  +++K+S+S    +P++LS+   SLT++IICR+  G+ +++      + R   L+ E+     +F
Sbjct:   51 PHRCFHKLSIKYGPLVFLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLSYGFKDITFAPYGEYWREVRKLAVIELFSSKKVQSFRYIREEEVDFVVKKVSESALKQSPVDLSKTFFSLTASIICRVALGQNFNESGFVIDQDRIEELVTESAEALGTF 217          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BY_ARATH (Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=CYP71B37 PE=2 SV=2)

HSP 1 Score: 154.451 bits (389), Expect = 5.122e-37
Identity = 74/167 (44.31%), Postives = 107/167 (64.07%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P  S W LS+KYGP+M L+ G +P++VVSS++ AK+ LK HDL  CSRP+L G + LSYN LD+ FSP++ YW+E+R++CV  LF   +V   +PIRE+EV +++   S+S A   P+NLSE + SLT  +IC+  FG  +      S    F  L+++      SF
Sbjct:   51 PHQSLWSLSKKYGPVMLLKFGSIPTVVVSSSETAKQALKIHDLNCCSRPSLAGPRALSYNYLDIVFSPFNDYWKELRRMCVQELFSPKQVHLIQPIREEEVKKLMNSFSESAAQKTPVNLSEKLASLTVGVICKAAFGVSFQGTVLNS--DNFDKLIHDAFLFLGSF 215          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71B9_ARATH (Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CYP71B9 PE=2 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 6.690e-37
Identity = 69/137 (50.36%), Postives = 102/137 (74.45%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGF 596
            P  S W LS+ YGP+M L+LG VP++VVSS++ AK++LK +DL  CSRP+L G ++LSYN LD+AFSP+D YW+E+R+ICV  LF + RV + +PI+E+EV ++I   ++S +  +P+NLSE    LT ++IC+  F
Sbjct:   51 PHQSLWSLSKTYGPVMLLKLGSVPTVVVSSSETAKQVLKINDLHCCSRPSLAGAKELSYNYLDIAFSPFDDYWKELRRICVQELFSAKRVHSIQPIKEEEVRKLIVSATESASQKSPVNLSEKFLDLTVSVICKAAF 187          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71A1_PERAE (Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.542e-36
Identity = 75/169 (44.38%), Postives = 114/169 (67.46%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSFFV 692
            P  S   L+ + GPL+ L LG +P+L+VS+A++A+EILKTHDL F SRP+    +++ Y+  D+AFSPY  YWR++RKICV+ L    RV ++R IRE+EV  M+E+IS+S +    +NLSE++  L+S  I R+ FGK+Y+ ++    +++F  L  E   L  +FFV
Sbjct:   51 PHRSLRSLANELGPLILLHLGHIPTLIVSTAEIAEEILKTHDLIFASRPSTTAARRIFYDCTDVAFSPYGEYWRQVRKICVLELLSIKRVNSYRSIREEEVGLMMERISQSCSTGEAVNLSELLLLLSSGTITRVAFGKKYEGEE--ERKNKFADLATELTTLMGAFFV 217          
BLAST of DR403185 vs. ExPASy Swiss-Prot
Match: C71BA_ARATH (Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.108e-34
Identity = 70/167 (41.92%), Postives = 111/167 (66.47%), Query Frame = 3
Query:  186 PQVSFWELSRKYGPLMSLRLGFVPSLVVSSAKLAKEILKTHDLQFCSRPALVGQQKLSYNGLDLAFSPYDGYWREIRKICVIHLFDSNRVENFRPIREDEVSRMIEKISKSVAASNPLNLSEVMRSLTSTIICRIGFGKRYDDDKATSARSRFHALLNETQALFVSF 686
            P  S  +LS+KYGP+M L+LG VP+++VS+ + AK++LK +DL  CSRP+L G +KLSYN LD+AFS +D YW+E+RK+CV  LF + R+ + +PI+E E+ ++I+ I++S +    +NLS+   SL   +IC+  FG  +      +   +F  L++E   +  SF
Sbjct:   50 PHQSLCKLSKKYGPVMLLKLGRVPTVIVSTPETAKQVLKDYDLHCCSRPSLEGTRKLSYNYLDIAFSRFDDYWKELRKLCVEELFCNKRINSIQPIKEAEMEKLIDSIAESASQKTLVNLSDTFLSLNVNVICKAVFGVNFQGTVLNN--DKFQDLVHEALEMLGSF 214          
The following BLAST results are available for this feature:
BLAST of DR403185 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 126
Match NameE-valueIdentityDescription
C71BX_ARATH5.847e-4147.31Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=C... [more]
C71BW_ARATH8.443e-4044.31Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=C... [more]
C71BV_ARATH8.443e-4044.91Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=C... [more]
C83B1_ARATH3.208e-3945.71Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CY... [more]
C71BQ_ARATH1.219e-3842.68Cytochrome P450 71B26 OS=Arabidopsis thaliana GN=C... [more]
C71B2_ARATH3.922e-3744.91Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CY... [more]
C71BY_ARATH5.122e-3744.31Cytochrome P450 71B37 OS=Arabidopsis thaliana GN=C... [more]
C71B9_ARATH6.690e-3750.36Cytochrome P450 71B9 OS=Arabidopsis thaliana GN=CY... [more]
C71A1_PERAE2.542e-3644.38Cytochrome P450 71A1 OS=Persea americana GN=CYP71A... [more]
C71BA_ARATH3.108e-3441.92Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=C... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCSAF-PNP1244B14 Flavedo Mature Citrus sinensis cDNA clone CSAF-PNP1244B14 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DR403185 ID=DR403185|Name=DR403185|organism=Citrus sinensis|type=EST|length=693bp
GGGGAAGCGCATAGAAGATATTAATGGCTTTACTTATCATCATCAACTTC
CTTTTGTGTCTCCCCTTCTTCCTCTTCTTCTTTGCTTTGCAAAGGCTCAT
AACCTCAAGAAATAATACTAAATTACCACCCGGCCCCTGGGGCCTTCCCT
TAATCGGTAACTTACACCAGTTTGATGTCTCAAAGCCTCAAGTGTCATTT
TGGGAGCTGTCACGGAAATATGGCCCCCTCATGTCCTTGCGTCTTGGTTT
TGTGCCATCCCTAGTAGTTTCCTCAGCAAAACTGGCTAAAGAGATATTAA
AAACCCATGACCTTCAATTTTGTAGCAGGCCAGCCTTGGTAGGACAACAA
AAGTTATCTTACAATGGTCTTGATTTGGCGTTTTCACCCTATGATGGTTA
TTGGAGAGAGATAAGAAAAATTTGTGTCATTCATCTCTTTGACTCTAACA
GGGTAGAAAATTTTCGACCCATTAGAGAAGATGAAGTTTCAAGAATGATT
GAAAAGATTTCAAAATCAGTTGCTGCTTCTAATCCCTTAAACTTAAGTGA
GGTAATGAGGTCTCTTACAAGCACCATTATTTGTAGAATTGGATTTGGCA
AGAGGTATGATGACGATAAAGCAACAAGTGCAAGAAGTAGATTCCATGCC
CTGCTTAATGAAACTCAAGCCTTGTTTGTAAGCTTTTTTGTTA
back to top