DN617361
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS7_ARATH (Callose synthase 7 OS=Arabidopsis thaliana GN=CALS7 PE=2 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 5.723e-20 Identity = 37/57 (64.91%), Postives = 45/57 (78.95%), Query Frame = -2 Query: 201 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIVTRRKD*DSNKLK 371 +EY+M L +F PIA+ SW PF SEFQTRLLFNQAFSRGLQISMI+ +KD ++ K Sbjct: 1877 YEYIMGLVIFTPIAVLSWFPFVSEFQTRLLFNQAFSRGLQISMILAGKKDKETPSTK 1933 HSP 2 Score: 37.7354 bits (86), Expect = 5.723e-20 Identity = 15/22 (68.18%), Postives = 17/22 (77.27%), Query Frame = -1 Query: 373 GQVCRPLFKAIGFWDSTKELGR 438 GQ R +FK +GFWDS KELGR Sbjct: 1854 GQALRSVFKGLGFWDSVKELGR 1875
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS6_ARATH (Putative callose synthase 6 OS=Arabidopsis thaliana GN=CALS6 PE=3 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.397e-17 Identity = 35/50 (70.00%), Postives = 40/50 (80.00%), Query Frame = -2 Query: 222 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIVTRRKD 371 +E +M L +FAPIA+ SW P SEFQ RLLFNQAFSRGLQISMI+ RKD Sbjct: 1865 YENIMGLVIFAPIAVLSWFPIVSEFQARLLFNQAFSRGLQISMILAGRKD 1914 HSP 2 Score: 34.2686 bits (77), Expect = 2.397e-17 Identity = 15/22 (68.18%), Postives = 16/22 (72.73%), Query Frame = -1 Query: 373 GQVCRPLFKAIGFWDSTKELGR 438 GQV R KA+G WDS KELGR Sbjct: 1842 GQVLRSPIKALGVWDSVKELGR 1863
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS2_ARATH (Callose synthase 2 OS=Arabidopsis thaliana GN=CALS2 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 4.764e-14 Identity = 33/57 (57.89%), Postives = 42/57 (73.68%), Query Frame = -2 Query: 201 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIVTRRKD*DSNKLK 371 +E LM L +F P+A +W PF SEFQTR+LFNQAFSRGLQIS I+ ++ S+K K Sbjct: 1894 YEILMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNK 1950 HSP 2 Score: 30.0314 bits (66), Expect = 4.764e-14 Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = -1 Query: 373 QVCRPLFKAIGFWDSTKELGR 435 Q C+PL + +GFW S + L R Sbjct: 1872 QACKPLIQRLGFWSSVRTLAR 1892
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS5_ARATH (Callose synthase 5 OS=Arabidopsis thaliana GN=CALS5 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 4.765e-14 Identity = 29/49 (59.18%), Postives = 37/49 (75.51%), Query Frame = -2 Query: 225 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIVTRRK 371 +EY+M + +F P+ + +W PF SEFQTRLLFNQAFSRGLQI I+ K Sbjct: 1872 YEYIMGVVIFMPVTVLAWFPFVSEFQTRLLFNQAFSRGLQIQRILAGGK 1920 HSP 2 Score: 30.4166 bits (67), Expect = 4.765e-14 Identity = 12/24 (50.00%), Postives = 14/24 (58.33%), Query Frame = -1 Query: 373 KFGQVCRPLFKAIGFWDSTKELGR 444 + QV RPL K +G W S K L R Sbjct: 1847 QISQVARPLMKTVGMWGSVKALAR 1870
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS1_ARATH (Callose synthase 1 OS=Arabidopsis thaliana GN=CALS1 PE=1 SV=2) HSP 1 Score: 66.2402 bits (160), Expect = 5.006e-13 Identity = 32/57 (56.14%), Postives = 42/57 (73.68%), Query Frame = -2 Query: 201 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIVTRRKD*DSNKLK 371 +E +M L +F P+A +W PF SEFQTR+LFNQAFSRGLQIS I+ ++ S+K K Sbjct: 1893 YEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGQRKDRSSKNK 1949 HSP 2 Score: 27.7202 bits (60), Expect = 5.006e-13 Identity = 9/21 (42.86%), Postives = 13/21 (61.90%), Query Frame = -1 Query: 373 QVCRPLFKAIGFWDSTKELGR 435 Q C+PL + +G W S + L R Sbjct: 1871 QACKPLIQQLGIWSSVRTLAR 1891
BLAST of DN617361 vs. ExPASy Swiss-Prot
Match: CALS3_ARATH (Callose synthase 3 OS=Arabidopsis thaliana GN=CALS3 PE=2 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 2.398e-12 Identity = 32/51 (62.75%), Postives = 39/51 (76.47%), Query Frame = -2 Query: 222 HEYLMRLPVFAPIAIFSWLPFASEFQTRLLFNQAFSRGLQISMIV-TRRKD 371 +E +M L +F P+A +W PF SEFQTR+LFNQAFSRGLQIS I+ RKD Sbjct: 1907 YEIVMGLLLFTPVAFLAWFPFVSEFQTRMLFNQAFSRGLQISRILGGHRKD 1957 HSP 2 Score: 26.1794 bits (56), Expect = 2.398e-12 Identity = 9/21 (42.86%), Postives = 12/21 (57.14%), Query Frame = -1 Query: 373 QVCRPLFKAIGFWDSTKELGR 435 Q C+P+ GFW S + L R Sbjct: 1885 QACKPVVHRAGFWGSVRTLAR 1905 The following BLAST results are available for this feature:
BLAST of DN617361 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 6
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617361 ID=DN617361; Name=DN617361; organism=Citrus sinensis; type=EST; length=492bpback to top |