DN617303

Overview
NameDN617303
Unique NameDN617303
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5707 contig Csv1_Contig5707:433..1116. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617303 vs. ExPASy Swiss-Prot
Match: SPC3B_ARATH (Signal peptidase complex subunit 3B OS=Arabidopsis thaliana GN=At5g27430 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 7.241e-20
Identity = 43/48 (89.58%), Postives = 45/48 (93.75%), Query Frame = -2
Query:  540 KYRFIDQGHNLRGKEFNLTLHWHVMPKTGKMFANKIVMSGYHLPEDYR 683
            KYRFIDQGHNLRGK+FNLTLHWHVMPKTGKMFA+KIVMSGY LP  YR
Sbjct:  120 KYRFIDQGHNLRGKDFNLTLHWHVMPKTGKMFADKIVMSGYRLPNAYR 167          
BLAST of DN617303 vs. ExPASy Swiss-Prot
Match: SPC3A_ARATH (Signal peptidase complex subunit 3A OS=Arabidopsis thaliana GN=At3g05230 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.973e-18
Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = -2
Query:  540 KYRFIDQGHNLRGKEFNLTLHWHVMPKTGKMFANKIVMSGYHLPEDYR 683
            KYRFIDQG NLRGK+FNLTLHWHVMPKTGKMFA+KIV+ GY LP+ YR
Sbjct:  120 KYRFIDQGQNLRGKDFNLTLHWHVMPKTGKMFADKIVLPGYSLPDAYR 167          
The following BLAST results are available for this feature:
BLAST of DN617303 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
SPC3B_ARATH7.241e-2089.58Signal peptidase complex subunit 3B OS=Arabidopsis... [more]
SPC3A_ARATH3.973e-1883.33Signal peptidase complex subunit 3A OS=Arabidopsis... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A12_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617303 ID=DN617303|Name=DN617303|organism=Citrus sinensis|type=EST|length=684bp
ATTCATATCATCAATTAAATCTAACTCAACCTCCACATCATCAACTACAA
CATTCAAAGAAAACAGTAGAAACAAAAACACACCTTTCCATAAACTTGAG
CAAATCCAAAGGCATCAATTTTCTCCAATTGCTCCAAGCCTTTGACTCGT
CCAATCTCACAATCTTCACTCATCTCCATCTCACTCCTCTTCTCATTTCT
ACTCAATCCCAAATCAGTCCAAAACACAATCCCAACAAAGAACAAATAAA
ACCCAACAAACCCGACAGCTTGCCAAACAAAAATCTCCCCACTCAAGTAC
ACATAAAACAACAACAAAGCAGCCACCAAGTAAATAAGAGGGGGAAATGC
CGCCAAAAGATCATAATCCAAGCTTTTGCAAAAAAGAATTAAGTTTTTAA
AATTCCAAGCAACATTCATGTTCTCAATTTATAGAACAAGAAAATTCTTC
TATTTCTAGTTTCTAGTTCAGCTGACATTCAACAGTCCCTTAAAGAAAGC
TAAAGTTACGGGAAAGACATACACTCAACAGATTCACTATCTGTAATCCT
CAGGCAAGTGATATCCAGACATGACTATTTTGTTGGCAAACATCTTGCCG
GTCTTGGGCATGACGTGCCAGTGCAATGTCAAGTTGAATTCTTTACCTCG
AAGATTGTGTCCCTGATCAATGAAACGATATTTG
back to top