DN617300

Overview
NameDN617300
Unique NameDN617300
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length514
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10172 contig Csv1_Contig10172:29..542. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 4.507e-72
Identity = 123/156 (78.85%), Postives = 148/156 (94.87%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+C+KE+RE+T KHPW++M TS DE QFL+MLLKL+NAKNTMEIGV+TGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NYINYHK
Sbjct:   19 GHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHK 174          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT2_POPTR (Caffeoyl-CoA O-methyltransferase 2 OS=Populus trichocarpa GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.311e-71
Identity = 123/156 (78.85%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+C+KE+RELT KHPW++M TS DE QFL+MLLKLINAKNTMEIGVFTGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAG+ HKI+F+EGPALP+LDQ+I+D KYHGT+DF+FVDADK+NYINYHK
Sbjct:   19 GHKSLLQSDALYQYILETSVYPREPECMKELRELTAKHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGLEHKIEFKEGPALPVLDQMIEDGKYHGTYDFIFVDADKDNYINYHK 174          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT_VITVI (Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 2.921e-71
Identity = 123/156 (78.85%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RELT +HPW++M TS DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI KE+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NY+NYHK
Sbjct:   14 GHKSLLQSDALYQYILETSVYPREPESMKELRELTAQHPWNIMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHK 169          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT1_POPTR (Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 4.983e-71
Identity = 122/156 (78.21%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+C+KE+RE+T KHPW++M TS DE QFL+MLLKL+NAKNTMEIGV+TGYSLLATALAIP+DGKILA+DI +E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D K HG+FDF+FVDADK+NYINYHK
Sbjct:   19 GHKSLLQSDALYQYILETSVYPREPECMKELREVTAKHPWNIMTTSADEGQFLNMLLKLVNAKNTMEIGVYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHK 174          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT2_EUCGL (Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 6.508e-71
Identity = 123/156 (78.85%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E++E GLP+I+KAG+AHKIDFREGPALPLLDQL+QDEK HGT+DF+FVDADK+NYINYHK
Sbjct:   19 GHKSLLQSDALYQYILETSVYPREPESMKELREITAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIEKAGLAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHK 174          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT_PETCR (Caffeoyl-CoA O-methyltransferase OS=Petroselinum crispum PE=1 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.894e-70
Identity = 123/156 (78.85%), Postives = 145/156 (92.95%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALA+PDDGKILA+DI +E+YE GLPII+KAGV HKIDFREGPALP+LD +++D KYHGTFDFVFVDADK+NYINYHK
Sbjct:   13 GHKSLLQSDALYQYILETSVYPREPEAMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEKAGVGHKIDFREGPALPVLDHMLEDGKYHGTFDFVFVDADKDNYINYHK 168          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT_SOLTU (Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.473e-70
Identity = 120/156 (76.92%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFL+MLLKLINAKNTMEIGVFTGYSLLATA+A+PDDGKILA+DI +E+YE GLP+I+KAG+AHKIDFREGPALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHK
Sbjct:   14 GHKSLLQSDALYQYILETSVYPREPEAMKELREITAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIDFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHK 169          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 2.473e-70
Identity = 123/156 (78.85%), Postives = 147/156 (94.23%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFL+MLLKLINAKNTMEIGV+TGYSLLATALAIPDDGKILA+DI +E+YE GLPII+KAGVAHKI+FREGPALP+LDQL++D+K HGT+DF+FVDADK+NYINYHK
Sbjct:   12 GHKSLLQSDALYQYILETSVYPREPESMKELREVTAKHPWNLMTTSADEGQFLNMLLKLINAKNTMEIGVYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHK 167          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT_ZINEL (Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 4.219e-70
Identity = 123/156 (78.85%), Postives = 146/156 (93.59%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREPQ +KE+R +T KHPW++M TS DE QFL++LLKLINAKNTMEIGV+TGYSLL+TALA+P+DGKILALDI +E+YE GLPIIQKAGVAHKIDFREGPALPLLDQ++QDEK HG+FDF+FVDADK+NY+NYHK
Sbjct:   17 GHKSLLQSDALYQYILETSVYPREPQPMKELRRITAKHPWNLMTTSADEGQFLNLLLKLINAKNTMEIGVYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIQKAGVAHKIDFREGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHK 172          
BLAST of DN617300 vs. ExPASy Swiss-Prot
Match: CAMT4_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g34050 OS=Arabidopsis thaliana GN=At4g34050 PE=2 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.603e-69
Identity = 118/156 (75.64%), Postives = 146/156 (93.59%), Query Frame = 2
Query:   47 GNKTLLQSEKLYEYILETSVYPREPQCLKEIRELTDKHPWSVMMTSPDEAQFLSMLLKLINAKNTMEIGVFTGYSLLATALAIPDDGKILALDITKEHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHK 514
            G+K+LLQS+ LY+YILETSVYPREP+ +KE+RE+T KHPW++M TS DE QFL+ML+KL+NAKNTMEIGV+TGYSLLATALA+P+DGKILA+D+ +E+YE GLPII+KAGVAHKIDFREGPALP+LD+++ DEK HGT+DF+FVDADK+NYINYHK
Sbjct:   31 GHKSLLQSDDLYQYILETSVYPREPESMKELREVTAKHPWNIMTTSADEGQFLNMLIKLVNAKNTMEIGVYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHK 186          
The following BLAST results are available for this feature:
BLAST of DN617300 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
CAMT_POPTM4.507e-7278.85Caffeoyl-CoA O-methyltransferase OS=Populus tremul... [more]
CAMT2_POPTR1.311e-7178.85Caffeoyl-CoA O-methyltransferase 2 OS=Populus tric... [more]
CAMT_VITVI2.921e-7178.85Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera... [more]
CAMT1_POPTR4.983e-7178.21Caffeoyl-CoA O-methyltransferase 1 OS=Populus tric... [more]
CAMT2_EUCGL6.508e-7178.85Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus g... [more]
CAMT_PETCR1.894e-7078.85Caffeoyl-CoA O-methyltransferase OS=Petroselinum c... [more]
CAMT_SOLTU2.473e-7076.92Caffeoyl-CoA O-methyltransferase OS=Solanum tubero... [more]
CAMT5_TOBAC2.473e-7078.85Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana ta... [more]
CAMT_ZINEL4.219e-7078.85Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans... [more]
CAMT4_ARATH1.603e-6975.64Probable caffeoyl-CoA O-methyltransferase At4g3405... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A10_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617300 ID=DN617300|Name=DN617300|organism=Citrus sinensis|type=EST|length=514bp
AGAAGGTCAGGAGGAAAATAAGGATCGTTACTTCAAAACTCTACATGGGA
ACAAGACCCTTTTACAGAGTGAAAAACTTTATGAGTATATACTTGAAACC
AGTGTATATCCAAGAGAACCACAATGCTTGAAGGAGATCCGCGAGTTGAC
GGACAAGCATCCATGGAGCGTCATGATGACTTCACCTGATGAAGCACAAT
TTTTGAGCATGCTACTCAAGCTTATCAATGCCAAGAATACCATGGAAATT
GGCGTTTTCACTGGTTACTCTCTCTTAGCCACTGCCCTTGCCATTCCCGA
CGATGGCAAGATACTGGCCCTGGACATCACCAAGGAACACTACGAGAAGG
GTCTCCCTATAATTCAAAAAGCTGGTGTTGCTCACAAGATTGACTTCAGA
GAAGGCCCTGCTCTTCCTCTTCTTGATCAATTGATCCAAGACGAAAAATA
TCATGGGACATTCGACTTCGTCTTTGTTGATGCTGACAAGAATAACTACA
TTAATTACCACAAG
back to top