DN617299

Overview
NameDN617299
Unique NameDN617299
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length596
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11071 contig Csv1_Contig11071:367..962. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT_POPTM (Caffeoyl-CoA O-methyltransferase OS=Populus tremuloides PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 3.022e-58
Identity = 103/132 (78.03%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NYINYHKRLIELVKVGG+IGYDNTLW GSVVA PDA + +++ Y RDFV ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  115 ENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT_ZINEL (Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 6.733e-58
Identity = 104/132 (78.79%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLPIIQKAGVAHKIDFREGPALPLLDQ++QDEK HG+FDF+FVDADK+NY+NYHKRLI+LVK GGVIGYDNTLW GS+VA  DA L +++ Y RDFV ELNKALAVDPR+EICQL + DG+TLCRRI
Sbjct:  113 ENYEIGLPIIQKAGVAHKIDFREGPALPLLDQMLQDEKCHGSFDFIFVDADKDNYLNYHKRLIDLVKFGGVIGYDNTLWNGSLVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICQLPVGDGITLCRRI 244          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT_VITVI (Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 223.402 bits (568), Expect = 6.733e-58
Identity = 101/132 (76.52%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D KYHG+FDF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L +++ Y RDFV ELNKALA DPRIEIC L + DG+TLCRR+
Sbjct:  110 ENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKYHGSFDFIFVDADKDNYLNYHKRLIDLVKVGGIIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRL 241          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT_SOLTU (Caffeoyl-CoA O-methyltransferase OS=Solanum tuberosum GN=CCOAOMT PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 1.148e-57
Identity = 101/132 (76.52%), Postives = 120/132 (90.91%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+I+KAG+AHKIDFREGPALP+LDQ+I+D KYHG++DF+FVDADK+NY+NYHKRLI+LVKVGG+IGYDNTLW GSVVA PDA L +++ Y RDFV ELNKALA DPRIEICQL + DG+TLCRRI
Sbjct:  110 ENYEIGLPVIEKAGLAHKIDFREGPALPVLDQMIEDGKYHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAADPRIEICQLPVGDGITLCRRI 241          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT2_EUCGL (Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus globulus GN=CCOAOMT2 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.341e-57
Identity = 101/132 (76.52%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E++E GLP+I+KAG+AHKIDFREGPALPLLDQL+QDEK HGT+DF+FVDADK+NYINYHKRLI+LVKVGG+IGYDNTLW GSVVA  DA L +++ Y RDFV ELNKALAVDPR+EIC L + DG+TLCRR+
Sbjct:  115 ENFEIGLPVIEKAGLAHKIDFREGPALPLLDQLVQDEKNHGTYDFIFVDADKDNYINYHKRLIDLVKVGGLIGYDNTLWNGSVVAPADAPLRKYVRYYRDFVLELNKALAVDPRVEICMLPVGDGITLCRRV 246          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT1_POPTR (Caffeoyl-CoA O-methyltransferase 1 OS=Populus trichocarpa GN=CCOAOMT1 PE=2 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 3.341e-57
Identity = 102/132 (77.27%), Postives = 118/132 (89.39%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+IQKAGVAHKIDF+EGPALP+LDQ+I+D K HG+FDF+FVDADK+NYINYHKRLIELVKVGG+IGYDNTLW GSVVA PDA + +++ Y RDFV ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  115 ENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKCHGSFDFIFVDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT4_ARATH (Probable caffeoyl-CoA O-methyltransferase At4g34050 OS=Arabidopsis thaliana GN=At4g34050 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 4.364e-57
Identity = 100/132 (75.76%), Postives = 118/132 (89.39%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLPII+KAGVAHKIDFREGPALP+LD+++ DEK HGT+DF+FVDADK+NYINYHKRLI+LVK+GGVIGYDNTLW GSVVA PDA + +++ Y RDFV ELNKALA DPRIEIC L + DG+T+CRRI
Sbjct:  127 ENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKNHGTYDFIFVDADKDNYINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITICRRI 258          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT6_TOBAC (Caffeoyl-CoA O-methyltransferase 6 OS=Nicotiana tabacum GN=CCOAOMT6 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 9.722e-57
Identity = 101/132 (76.52%), Postives = 117/132 (88.64%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+IQKAGVAHKIDFREGPALP+LD +I+D+  HGT+DF+FVDADK+NYINYHKR+IELVKVGGVIGYDNTLW GSVVA PDA + +++ Y RDFV ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  115 ENYELGLPVIQKAGVAHKIDFREGPALPVLDLMIEDKNNHGTYDFIFVDADKDNYINYHKRIIELVKVGGVIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 246          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT5_TOBAC (Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana tabacum GN=CCOAOMT5 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 9.722e-57
Identity = 100/132 (75.76%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLPII+KAGVAHKI+FREGPALP+LDQL++D+K HGT+DF+FVDADK+NYINYHKR+I+LVKVGG+IGYDNTLW GSVVA PDA + +++ Y RDFV ELNKALA DPRIEIC L + DG+TLCRRI
Sbjct:  108 ENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLVEDKKNHGTYDFIFVDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNKALAADPRIEICMLPVGDGITLCRRI 239          
BLAST of DN617299 vs. ExPASy Swiss-Prot
Match: CAMT_MEDSA (Caffeoyl-CoA O-methyltransferase OS=Medicago sativa GN=CCOMT PE=1 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.270e-56
Identity = 100/132 (75.76%), Postives = 119/132 (90.15%), Query Frame = -2
Query:  200 EHYEKGLPIIQKAGVAHKIDFREGPALPLLDQLIQDEKYHGTFDFVFVDADKNNYINYHKRLIELVKVGGVIGYDNTLWGGSVVAQPDAELDEHILYLRDFVQELNKALAVDPRIEICQLSIADGVTLCRRI 595
            E+YE GLP+I+KAGV HKIDFREGPALP+LD++I+DEK HG++DF+FVDADK+NY+NYHKRLI+LVKVGGVIGYDNTLW GSVVA PDA L +++ Y RDFV ELNKALAVDPRIEIC L + DG+T+CRRI
Sbjct:  115 ENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRKYVRYYRDFVLELNKALAVDPRIEICMLPVGDGITICRRI 246          
The following BLAST results are available for this feature:
BLAST of DN617299 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 33
Match NameE-valueIdentityDescription
CAMT_POPTM3.022e-5878.03Caffeoyl-CoA O-methyltransferase OS=Populus tremul... [more]
CAMT_ZINEL6.733e-5878.79Caffeoyl-CoA O-methyltransferase OS=Zinnia elegans... [more]
CAMT_VITVI6.733e-5876.52Caffeoyl-CoA O-methyltransferase OS=Vitis vinifera... [more]
CAMT_SOLTU1.148e-5776.52Caffeoyl-CoA O-methyltransferase OS=Solanum tubero... [more]
CAMT2_EUCGL3.341e-5776.52Caffeoyl-CoA O-methyltransferase 2 OS=Eucalyptus g... [more]
CAMT1_POPTR3.341e-5777.27Caffeoyl-CoA O-methyltransferase 1 OS=Populus tric... [more]
CAMT4_ARATH4.364e-5775.76Probable caffeoyl-CoA O-methyltransferase At4g3405... [more]
CAMT6_TOBAC9.722e-5776.52Caffeoyl-CoA O-methyltransferase 6 OS=Nicotiana ta... [more]
CAMT5_TOBAC9.722e-5775.76Caffeoyl-CoA O-methyltransferase 5 OS=Nicotiana ta... [more]
CAMT_MEDSA1.270e-5675.76Caffeoyl-CoA O-methyltransferase OS=Medicago sativ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A10_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617299 ID=DN617299|Name=DN617299|organism=Citrus sinensis|type=EST|length=596bp
AATTTTATTTTATTAAGTGGCCTTGACAATAAAATATAACATTTATTTTT
TAAAAAGTTATTAACTTAAGAAAGACAATAATACATTTTTCCAAACACTC
ATAAGTCTAATTTATTTGTGGATTCTACGGTCATAACCACACATAGTTTA
AAAGTTACGACACAACCAGCCTCATGAGTGAAAATTGAGAGGATCAGCCA
ATGCGGCGACATAATGTAACCCCATCAGCAATGGAGAGCTGGCAAATCTC
AATCCTTGGATCAACGGCCAGGGCCTTGTTGAGTTCCTGCACAAAATCCC
TCAAGTATAAGATATGCTCATCCAGTTCGGCATCAGGTTGTGCCACCACG
GATCCACCCCACAAGGTGTTGTCGTAGCCAATCACTCCCCCAACCTTCAC
AAGCTCAATAAGCCTCTTGTGGTAATTAATGTAGTTATTCTTGTCAGCAT
CAACAAAGACGAAGTCGAATGTCCCATGATATTTTTCGTCTTGGATCAAT
TGATCAAGAAGAGGAAGAGCAGGGCCTTCTCTGAAGTCAATCTTGTGAGC
AACACCAGCTTTTTGAATTATAGGGAGACCCTTCTCGTAGTGTTCC
back to top