DN617297

Overview
NameDN617297
Unique NameDN617297
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length630
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13130 contig Csv1_Contig13130:953..1582. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 8.024e-44
Identity = 79/94 (84.04%), Postives = 86/94 (91.49%), Query Frame = -3
Query:  347 HAVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 628
            HAVGLV PVS+AFEV+  FR YKSGVY+ + CG+TPMDVNHAV+AVGYGVEDGVPYWLIKNSWG +WGD GYFKMEMGKNMCGIATCASYPVVA
Sbjct:  265 HAVGLVRPVSIAFEVIHSFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIATCASYPVVA 358          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CYSP2_MAIZE (Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 1.048e-43
Identity = 79/93 (84.95%), Postives = 85/93 (91.40%), Query Frame = -3
Query:  347 AVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 625
            AVGLV PVSVAFEV+ GFR YKSGVY+S  CG TPMDVNHAV+AVGYGVEDGVPYWLIKNSWG +WGD GYFKMEMGKNMCG+ATCASYP+VA
Sbjct:  268 AVGLVRPVSVAFEVITGFRLYKSGVYTSDHCGTTPMDVNHAVLAVGYGVEDGVPYWLIKNSWGADWGDEGYFKMEMGKNMCGVATCASYPIVA 360          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: ALEUL_ARATH (Thiol protease aleurain-like OS=Arabidopsis thaliana GN=At3g45310 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.049e-43
Identity = 79/94 (84.04%), Postives = 85/94 (90.43%), Query Frame = -3
Query:  347 HAVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 628
            HAVGLV PVSVAFEVV  FRFYK GV++S  CGNTPMDVNHAV+AVGYGVED VPYWLIKNSWG  WGD+GYFKMEMGKNMCG+ATC+SYPVVA
Sbjct:  265 HAVGLVRPVSVAFEVVHEFRFYKKGVFTSNTCGNTPMDVNHAVLAVGYGVEDDVPYWLIKNSWGGEWGDNGYFKMEMGKNMCGVATCSSYPVVA 358          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 6.793e-43
Identity = 77/94 (81.91%), Postives = 88/94 (93.62%), Query Frame = -3
Query:  347 HAVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 628
            +AVGLV PVSVAF+V++GFR YKSGVY+S  CG +PMDVNHAV+AVGYGVE+GVPYWLIKNSWG +WGD+GYFKMEMGKNMCGIATCASYP+VA
Sbjct:  269 NAVGLVRPVSVAFQVINGFRMYKSGVYTSDHCGTSPMDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIATCASYPIVA 362          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CYSP3_SOLLC (Cysteine proteinase 3 OS=Solanum lycopersicum GN=CYP-3 PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.403e-42
Identity = 76/94 (80.85%), Postives = 87/94 (92.55%), Query Frame = -3
Query:  347 HAVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 628
            +AV LV PVSVAFEVV GF+ YKSGVY+ST+CG+TPMDVNHAV+AVGYGVE+G PYWLIKNSWG +WG+ GYFKMEMGKNMCG+ATCASYP+VA
Sbjct:  263 YAVALVRPVSVAFEVVKGFKQYKSGVYASTECGDTPMDVNHAVLAVGYGVENGTPYWLIKNSWGADWGEDGYFKMEMGKNMCGVATCASYPIVA 356          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.403e-42
Identity = 78/94 (82.98%), Postives = 86/94 (91.49%), Query Frame = -3
Query:  347 HAVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPVVA 628
            +AVGLV PVSVAF+V+DGFR YKSGVY+S  CG TP DVNHAV+AVGYGVE+GVPYWLIKNSWG +WGD+GYFKMEMGKNMC IATCASYPVVA
Sbjct:  268 NAVGLVRPVSVAFQVIDGFRQYKSGVYTSDHCGTTPDDVNHAVLAVGYGVENGVPYWLIKNSWGADWGDNGYFKMEMGKNMCAIATCASYPVVA 361          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CATH_RAT (Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.050e-31
Identity = 59/91 (64.84%), Postives = 71/91 (78.02%), Query Frame = -3
Query:  353 AVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 625
            AV L  PVS AFEV + F  YKSGVYSS  C  TP  VNHAV+AVGYG ++G+ YW++KNSWG NWG++GYF +E GKNMCG+A CASYP+
Sbjct:  240 AVALYNPVSFAFEVTEDFMMYKSGVYSSNSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSNWGNNGYFLIERGKNMCGLAACASYPI 330          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CATH_PIG (Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.677e-31
Identity = 58/91 (63.74%), Postives = 70/91 (76.92%), Query Frame = -3
Query:  353 AVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 625
            AV L  PVS AFEV + F  Y+ G+YSST C  TP  VNHAV+AVGYG E+G+PYW++KNSWG  WG +GYF +E GKNMCG+A CASYP+
Sbjct:  242 AVALYNPVSFAFEVTNDFLMYRKGIYSSTSCHKTPDKVNHAVLAVGYGEENGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPI 332          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CATH_HUMAN (Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4)

HSP 1 Score: 134.035 bits (336), Expect = 5.965e-31
Identity = 57/91 (62.64%), Postives = 70/91 (76.92%), Query Frame = -3
Query:  353 AVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 625
            AV L  PVS AFEV   F  Y++G+YSST C  TP  VNHAV+AVGYG ++G+PYW++KNSWG  WG +GYF +E GKNMCG+A CASYP+
Sbjct:  242 AVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPI 332          
BLAST of DN617297 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.329e-30
Identity = 58/91 (63.74%), Postives = 70/91 (76.92%), Query Frame = -3
Query:  353 AVGLV*PVSVAFEVVDGFRFYKSGVYSSTKCGNTPMDVNHAVVAVGYGVEDGVPYWLIKNSWGENWGDHGYFKMEMGKNMCGIATCASYPV 625
            AV L  PVS AFEV + F  YKSGVYSS  C  TP  VNHAV+AVGYG ++G+ YW++KNSWG  WG++GYF +E GKNMCG+A CASYP+
Sbjct:  240 AVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPI 330          
The following BLAST results are available for this feature:
BLAST of DN617297 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 152
Match NameE-valueIdentityDescription
ALEU_ARATH8.024e-4484.04Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]
CYSP2_MAIZE1.048e-4384.95Cysteine proteinase 2 OS=Zea mays GN=CCP2 PE=2 SV=... [more]
ALEUL_ARATH3.049e-4384.04Thiol protease aleurain-like OS=Arabidopsis thalia... [more]
ORYC_ORYSJ6.793e-4381.91Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
CYSP3_SOLLC4.403e-4280.85Cysteine proteinase 3 OS=Solanum lycopersicum GN=C... [more]
ALEU_HORVU4.403e-4282.98Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]
CATH_RAT2.050e-3164.84Cathepsin H OS=Rattus norvegicus GN=Ctsh PE=1 SV=1[more]
CATH_PIG2.677e-3163.74Cathepsin H OS=Sus scrofa GN=CTSH PE=1 SV=1[more]
CATH_HUMAN5.965e-3162.64Cathepsin H OS=Homo sapiens GN=CTSH PE=1 SV=4[more]
CATH_MOUSE1.329e-3063.74Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617297 ID=DN617297|Name=DN617297|organism=Citrus sinensis|type=EST|length=630bp
TTTTTTTTTTTTTTTTTAGGGGCAGAAGACAACCAAATTTTTTAAGCAAT
GCATTGATATTTGCCTAAAGCTTCCATATAACAACTACCTTGCATTGACA
AAATATATATAACATCGTTGGTGTCCTAGTCACAATGACTGTTTACATGG
ACATAGATCTCAGAATTTATTTTGAACATCAAGCAGCCATGCATTGCTAT
TGTAGATTATATGGACATTAATCTCCGAATTTATTTCGTACATAAAGCCA
ACCATTCTGCTATCATTCTTGAGTGAAATAATATAAGTTTTATGAGCAAA
TGACTTGCTGATAGCCAGATCCAACTATTTCTTCAGGAGCAGACTAAGCC
ACAACTGGGTATGATGCACAAGTTGCAATACCACACATGTTCTTCCCCAT
CTCCATCTTAAAGTAGCCATGATCGCCCCAGTTCTCTCCCCAAGAGTTCT
TAATCAGCCAATATGGAACACCATCTTCAACTCCGTACCCAACAGCAACG
ACGGCATGGTTCACATCCATGGGAGTATTTCCACATTTAGTGCTGCTGTA
AACTCCACTCTTGTAAAATCGGAATCCATCTACTACTTCAAATGCCACAC
TCACAGGTCAAACAAGACCAACTGCATGCT
back to top