DN617295

Overview
NameDN617295
Unique NameDN617295
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length606
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10118 contig Csv1_Contig10118:135..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617295 vs. ExPASy Swiss-Prot
Match: C3H24_ARATH (Zinc finger CCCH domain-containing protein 24 OS=Arabidopsis thaliana GN=At2g28450 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.609e-46
Identity = 101/150 (67.33%), Postives = 115/150 (76.67%), Query Frame = -2
Query:  135 IADSNCPEGSGK--EPQSQLQKDCTS-EGNSLAQP-FKNVVAIVDPPRGGLHPTVIKILRTHARLQRLVYISCNPETLVANAIELCTPSPDKIEK-NKDNRGWRNMSSAGLARHRAKSMPISKPFQPVKAMAVDLFPHTSHCEMVMLLER 569
            +AD N P  + +  E Q   QKD +S E     +P FKNVVAIVDPPR GLHP VIK LRTH RL+RLVYISCNPETLVANAIELCTPS D+ ++ NK+ RG + +  A LARHRAKSMP S+ F+PVKAMAVDLFPHT HCEMVMLLER
Sbjct:  660 VADQNLPPSNTQVEELQDNEQKDSSSLEPEKTTKPQFKNVVAIVDPPRSGLHPAVIKALRTHPRLKRLVYISCNPETLVANAIELCTPSFDEPDRGNKNYRGRKKIGIAALARHRAKSMPTSEAFRPVKAMAVDLFPHTDHCEMVMLLER 809          
BLAST of DN617295 vs. ExPASy Swiss-Prot
Match: TRM2A_HUMAN (tRNA (uracil-5-)-methyltransferase homolog A OS=Homo sapiens GN=TRMT2A PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 7.791e-17
Identity = 44/112 (39.29%), Postives = 63/112 (56.25%), Query Frame = -2
Query:  135 KNVVAIVDPPRGGLHPTVIKILRTHARLQRLVYISCNPETLVANAIELCTPSPDKIEKNKDNRGWRNMSSAGLARHRAKSMPISKPFQPVKAMAVDLFPHTSHCEMVMLLER 470
            +++VAI+DPPR GLH  VI  +R    L+RL+Y+SCNP   + N ++LC    ++++                            PF+PVKA+AVDLFP T HCEM++L ER
Sbjct:  503 QHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVK--------------------------GIPFRPVKAVAVDLFPQTPHCEMLILFER 588          
BLAST of DN617295 vs. ExPASy Swiss-Prot
Match: TRM2_DANRE (tRNA (uracil-5-)-methyltransferase homolog OS=Danio rerio GN=Trmt2b PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.375e-13
Identity = 44/111 (39.64%), Postives = 60/111 (54.05%), Query Frame = -2
Query:  135 VVAIVDPPRGGLHPTVIKILRTHARLQRLVYISCNPE-TLVANAIELCTPSPDKIEKNKDNRGWRNMSSAGLARHRAKSMPISKPFQPVKAMAVDLFPHTSHCEMVMLLER 464
            + A+V+P R GLH  V++ LR H+ ++RLVYISC P+   + N  ELC                    S GL R         + F+PV A+ VDLFPHT HCE+V++ ER
Sbjct:  387 LTAVVNPSRAGLHYRVVRALRNHSAIRRLVYISCKPDGEAMRNFRELC-------------------CSVGLVRRIT-----GEAFKPVVAVPVDLFPHTPHCELVLVFER 473          
The following BLAST results are available for this feature:
BLAST of DN617295 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
C3H24_ARATH1.609e-4667.33Zinc finger CCCH domain-containing protein 24 OS=A... [more]
TRM2A_HUMAN7.791e-1739.29tRNA (uracil-5-)-methyltransferase homolog A OS=Ho... [more]
TRM2_DANRE1.375e-1339.64tRNA (uracil-5-)-methyltransferase homolog OS=Dani... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A08_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617295 ID=DN617295|Name=DN617295|organism=Citrus sinensis|type=EST|length=606bp
CCCCCTTTTTTTTTTGGGACGACAAGGCTGTAACTATTAAAATTTTCATT
GGGCAGAAATAAGAATCCTTCAAACGTTCAAATTGGAGTTGGCTACATGA
CAAAATTGTGGCATCTTGAGTTATCGTCTAATTACCTCTCCAAGAGCATC
ACCATTTCACAGTGCGAAGTATGTGGGAAAAGATCCACTGCCATGGCTTT
TACAGGTTGGAAAGGCTTTGATATGGGCATGGATTTGGCTCTATGCCTGG
CCAAACCAGCACTGCTCATGTTCCTCCACCCCCTGTTGTCTTTATTTTTC
TCAATTTTATCTGGAGACGGTGTGCAAAGCTCAATAGCATTTGCTACTAA
GGTTTCAGGGTTACATGAAATGTAAACAAGCCTCTGCAGTCGTGCATGGG
TCCTCAAAATTTTAATGACAGTGGGATGAAGTCCGCCGCGTGGGGGATCA
ACAATAGCAACCACATTTTTAAACGGCTGCGCCAAAGAATTTCCCTCTGA
AGTGCAATCCTTCTGAAGTTGGCTTTGTGGTTCTTTTCCACTGCCTTCCG
GACAATTGGAATCAGCTATGTCATTTTCAGGGTCCTGGCCAGAGCACCCT
TCATTT
back to top