DN617291

Overview
NameDN617291
Unique NameDN617291
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length693
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7350 contig Csv1_Contig7350:249..941. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_POPJC (Peroxiredoxin Q, chloroplastic OS=Populus jackii GN=PRXQ PE=1 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 2.594e-81
Identity = 144/164 (87.80%), Postives = 155/164 (94.51%), Query Frame = -3
Query:  200 NLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 691
            +L IPSS+S K +I AKV+KGQAPPSFTLKDQ+G+ +SLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGDD SSHKAFAKKYRLP+TLLSDEGNK+RKEWGVPAD FG+LPGRQTYVLDK GVVQLIYNNQFQPEKHIDETLK LQS
Sbjct:   49 SLSIPSSSSVKNTIFAKVNKGQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDPSSHKAFAKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQS 212          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_GENTR (Peroxiredoxin Q, chloroplastic OS=Gentiana triflora GN=AFP1 PE=1 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.682e-80
Identity = 142/165 (86.06%), Postives = 153/165 (92.73%), Query Frame = -3
Query:  197 NLPIPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSS 691
            +LP P S S + S+ AKVSKG  PP FTLKDQ+G+NVSL++FKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD SSHKAFAKKYRLPYTLLSDEGNK+R+EWGVPAD FG+LPGRQTYVLDKNG VQLIYNNQFQPEKHIDETLKFLQS+
Sbjct:   53 SLPPPPSYSARISVFAKVSKGSVPPQFTLKDQDGKNVSLTEFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPYTLLSDEGNKIRREWGVPADLFGTLPGRQTYVLDKNGTVQLIYNNQFQPEKHIDETLKFLQSA 217          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PERQ_SUASA (Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=PRXQ PE=1 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.056e-78
Identity = 137/156 (87.82%), Postives = 150/156 (96.15%), Query Frame = -3
Query:  200 SFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 667
            S+K SI AKVS+G  PP+FTLKDQ+G+NVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAF +KY+LPYTLLSDEGNKVRK+WGVP+D FG+LPGRQTYVLD+NGVV+L+YNNQFQPEKHIDETLKFLQS
Sbjct:   58 SYKASIVAKVSEGSMPPAFTLKDQDGKNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFKQKYKLPYTLLSDEGNKVRKDWGVPSDLFGALPGRQTYVLDRNGVVRLVYNNQFQPEKHIDETLKFLQS 213          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PERQ_SEDLI (Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum lineare GN=PRXQ PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.740e-77
Identity = 138/160 (86.25%), Postives = 147/160 (91.88%), Query Frame = -3
Query:  200 PSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 679
            PS+   K SI AKV+KG  PP FTLKDQEGR VSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEV+GISGD S SHKAFAKKY+LP+TLLSDEGNKVRKEWGVP+D FG+LPGR+TYVLDKNGVVQL+YNNQFQPEKHIDETLK LQS
Sbjct:   25 PSAPLRKNSIFAKVTKGSTPPPFTLKDQEGRPVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDSSESHKAFAKKYKLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRETYVLDKNGVVQLVYNNQFQPEKHIDETLKLLQS 184          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_ARATH (Peroxiredoxin Q, chloroplastic OS=Arabidopsis thaliana GN=PRXQ PE=1 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 2.513e-76
Identity = 136/160 (85.00%), Postives = 148/160 (92.50%), Query Frame = -3
Query:  197 SSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSS 676
            SS+S K  I AKV+KGQA P FTLKDQ G+ VSL K+KGKPVV+YFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDS+SHKAFA KY+LPYTLLSDEGNKVRK+WGVP D FG+LPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFL+++
Sbjct:   57 SSSSLKGLIFAKVNKGQAAPDFTLKDQNGKPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSASHKAFASKYKLPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLKAA 216          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSJ (Peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0196300 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.056e-74
Identity = 133/161 (82.61%), Postives = 145/161 (90.06%), Query Frame = -3
Query:  200 IPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 682
            +PS+T     +  KVSKG A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKNGVVQ IYNNQFQPEKHI ETLK LQS
Sbjct:   56 LPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQS 216          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_ORYSI (Putative peroxiredoxin Q, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_22010 PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.056e-74
Identity = 133/161 (82.61%), Postives = 145/161 (90.06%), Query Frame = -3
Query:  200 IPSSTSFKTSISAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 682
            +PS+T     +  KVSKG A P+FTL+DQ+GR VSLSKFKG+PVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDD++SHK F KKY+LP+TLLSDEGNKVRKEWGVPAD FG+LPGRQTYVLDKNGVVQ IYNNQFQPEKHI ETLK LQS
Sbjct:   56 LPSTTGRNRIVCGKVSKGSAAPNFTLRDQDGRAVSLSKFKGRPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDAASHKEFKKKYKLPFTLLSDEGNKVRKEWGVPADLFGTLPGRQTYVLDKNGVVQYIYNNQFQPEKHIGETLKILQS 216          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: PRXQ_WHEAT (Peroxiredoxin Q, chloroplastic OS=Triticum aestivum GN=PRX1 PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 8.938e-74
Identity = 132/163 (80.98%), Postives = 145/163 (88.96%), Query Frame = -3
Query:  200 PIPSSTSFKTSI-SAKVSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPADFFGSLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQS 685
            P P   +  T I   KVSKG  PP+FTLKDQ+G+ VSLSKFKGKPVV+YFYPADETPGCTKQACAFRDSYEK+KKAGAEVIGISGDD++SHKAFAKKYRLP+TLLSDEGNKVRKEWGVP+D FG+LPGRQTYVLDK GVVQ IYNNQFQPEKHI ETLK +Q+
Sbjct:   54 PAPRRRAASTGIVCGKVSKGSVPPNFTLKDQDGKTVSLSKFKGKPVVLYFYPADETPGCTKQACAFRDSYEKYKKAGAEVIGISGDDAASHKAFAKKYRLPFTLLSDEGNKVRKEWGVPSDLFGTLPGRQTYVLDKKGVVQYIYNNQFQPEKHIGETLKIIQN 216          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: BCP_COXBU (Putative peroxiredoxin bcp OS=Coxiella burnetii GN=bcp PE=1 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.951e-28
Identity = 61/133 (45.86%), Postives = 86/133 (64.66%), Query Frame = -3
Query:  257 VSKGQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGVPAD---FFGSLPG--RQTYVLDKNGVVQLIY 640
            +  GQ  P FTL   EG  +SL   KGK V++YFYP D+TPGCTK+AC FRD + +  KAG  V+GIS D   +H++F +KY LP+TLLSD+ N V +++GV  D   F     G  R T+++D+ GV+  ++
Sbjct:    3 IEVGQKAPIFTLPTDEGEMLSLDDLKGKKVILYFYPKDDTPGCTKEACGFRDVWSQLSKAGVVVLGISKDSVKAHQSFKQKYNLPFTLLSDKDNTVCEQYGVMVDKNRFGKKYKGIERTTFLIDEEGVISAVW 135          
BLAST of DN617291 vs. ExPASy Swiss-Prot
Match: BCP_SHIFL (Putative peroxiredoxin bcp OS=Shigella flexneri GN=bcp PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 8.483e-24
Identity = 59/148 (39.86%), Postives = 92/148 (62.16%), Query Frame = -3
Query:  203 GQAPPSFTLKDQEGRNVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDSSSHKAFAKKYRLPYTLLSDEGNKVRKEWGV--PADFFGSLPG---RQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQ 631
            G   P F+L DQ+G  V+L+ F+G+ V+VYFYP   TPGCT QAC  RD+ ++ KKAG +V+GIS D       FA+K  L +TLLSDE ++V +++GV     F G       R ++++D +G ++ ++++ F+   H D  L +L+
Sbjct:    7 GDIAPKFSLPDQDGEQVNLTDFQGQRVLVYFYPKAMTPGCTVQACGLRDNMDELKKAGVDVLGISTDKPEKLSRFAEKELLNFTLLSDEDHQVCEQFGVWGEKSFMGKTYDGIHRISFLIDADGKIEHVFDD-FKTSNHHDVVLNWLK 153          
The following BLAST results are available for this feature:
BLAST of DN617291 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 69
Match NameE-valueIdentityDescription
PRXQ_POPJC2.594e-8187.80Peroxiredoxin Q, chloroplastic OS=Populus jackii G... [more]
PRXQ_GENTR1.682e-8086.06Peroxiredoxin Q, chloroplastic OS=Gentiana triflor... [more]
PERQ_SUASA2.056e-7887.82Peroxiredoxin Q, chloroplastic OS=Suaeda salsa GN=... [more]
PERQ_SEDLI1.740e-7786.25Peroxiredoxin Q, chloroplastic (Fragment) OS=Sedum... [more]
PRXQ_ARATH2.513e-7685.00Peroxiredoxin Q, chloroplastic OS=Arabidopsis thal... [more]
PRXQ_ORYSJ1.056e-7482.61Peroxiredoxin Q, chloroplastic OS=Oryza sativa sub... [more]
PRXQ_ORYSI1.056e-7482.61Putative peroxiredoxin Q, chloroplastic OS=Oryza s... [more]
PRXQ_WHEAT8.938e-7480.98Peroxiredoxin Q, chloroplastic OS=Triticum aestivu... [more]
BCP_COXBU1.951e-2845.86Putative peroxiredoxin bcp OS=Coxiella burnetii GN... [more]
BCP_SHIFL8.483e-2439.86Putative peroxiredoxin bcp OS=Shigella flexneri GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A05_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617291 ID=DN617291|Name=DN617291|organism=Citrus sinensis|type=EST|length=693bp
TTTTTTTTTTTTTTTTTGTGACAAGAAGTATCACTGATTTTTATTTCCTT
GTTAAACCAGAGTTGTTCAACTTGCTTGAGCTGAAAGTTTAATATTTCTT
ATTTCAGAAATTGAGGGTCTAAACTCAGCTAACAGCTTCGTTAATTACAG
AGGATTTTGAATCAAGCATGAACAAGGCAATACATTGAGATGTTCAACTG
CTTTGAAGAAACTTCAAGGTCTCATCAATGTGTTTTTCAGGTTGGAACTG
GTTGTTGTAGATGAGCTGAACCACTCCATTCTTGTCAAGAACGTAAGTCT
GTCTCCCAGGCAATGATCCAAAGAAGTCTGCTGGAACCCCCCATTCTTTC
CTCACCTTGTTACCCTCGTCGCTCAGCAATGTATATGGAAGCCTATACTT
TTTTGCAAATGCCTTGTGTGACGATGAATCATCACCACTAATCCCAATAA
CCTCAGCTCCTGCTTTCTTAAATTTCTCATAAGAATCCCTAAAAGCGCAT
GCCTGTTTGGTGCAGCCAGGTGTCTCATCAGCAGGGTAAAAATAAACAAC
CACGGGCTTCCCTTTAAACTTGGATAGGCTCACATTCCTGCCCTCTTGAT
CTTTCAATGTGAAGGAAGGAGGCGCCTGTCCTTTGCTCACCTTGGCAGAA
ATGGAAGTCTTGAAAGATGTGGAAGATGGGATTGGCAAGTTGG
back to top