DN617286

Overview
NameDN617286
Unique NameDN617286
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length496
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4014 contig Csv1_Contig4014:1028..1523. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB1_ARATH (Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 2.915e-33
Identity = 65/77 (84.42%), Postives = 73/77 (94.81%), Query Frame = -2
Query:  265 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEIGSQEDKSE 495
            HEPATKFLDG ++L SDGY++TKPGTT TSVPGVFAAGDVQDKKYRQA+TAAGTGCMAAL+AEHYLQEIGSQ+ KS+
Sbjct:  257 HEPATKFLDGGVELDSDGYVVTKPGTTQTSVPGVFAAGDVQDKKYRQAITAAGTGCMAALDAEHYLQEIGSQQGKSD 333          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB2_ARATH (Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 3.807e-33
Identity = 66/77 (85.71%), Postives = 72/77 (93.51%), Query Frame = -2
Query:  265 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEIGSQEDKSE 495
            HEPATKFLDGQL+L  DGY++TKPGTT TSV GVFAAGDVQDKKYRQA+TAAGTGCMAAL+AEHYLQEIGSQE KS+
Sbjct:  307 HEPATKFLDGQLELDEDGYVVTKPGTTKTSVVGVFAAGDVQDKKYRQAITAAGTGCMAALDAEHYLQEIGSQEGKSD 383          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_NEUCR (Thioredoxin reductase OS=Neurospora crassa GN=cys-9 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 6.092e-23
Identity = 48/68 (70.59%), Postives = 59/68 (86.76%), Query Frame = -2
Query:  292 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQE 495
            H+PAT  + GQL+  +DGY++TKPGTT TSV GVFAAGDVQDK+YRQA+T+AGTGCMAAL+AE +L E
Sbjct:  249 HDPATALVKGQLETDADGYVVTKPGTTLTSVEGVFAAGDVQDKRYRQAITSAGTGCMAALDAEKFLSE 316          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_CHLMU (Thioredoxin reductase OS=Chlamydia muridarum GN=trxB PE=3 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.366e-21
Identity = 46/68 (67.65%), Postives = 58/68 (85.29%), Query Frame = -2
Query:  292 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQE 495
            H+P T FL GQL L  +GYIIT+ G++ TSVPGVFAAGDVQDK YRQA+T+AG+GCMAAL+AE +L++
Sbjct:  245 HQPNTAFLGGQLSLDENGYIITEKGSSRTSVPGVFAAGDVQDKYYRQAITSAGSGCMAALDAERFLEK 312          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_PENCH (Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3)

HSP 1 Score: 98.5969 bits (244), Expect = 1.659e-20
Identity = 43/74 (58.11%), Postives = 61/74 (82.43%), Query Frame = -2
Query:  274 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEIGSQED 495
            H+PA+  + GQ++L  +GYIITKPGT+ T+V GVFA GDVQDK+YRQA+T+AG+GC+AALEAE ++ E  + ++
Sbjct:  256 HDPASGLVKGQVELDDEGYIITKPGTSFTNVEGVFACGDVQDKRYRQAITSAGSGCVAALEAEKFIAETETHQE 329          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_CHLTR (Thioredoxin reductase OS=Chlamydia trachomatis GN=trxB PE=3 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 2.167e-20
Identity = 45/67 (67.16%), Postives = 57/67 (85.07%), Query Frame = -2
Query:  295 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQ 495
            H+P T FL GQ+ L  +GYIIT+ G++ TSVPGVFAAGDVQDK YRQA+T+AG+GCMAAL+AE +L+
Sbjct:  245 HQPNTAFLGGQVALDENGYIITEKGSSRTSVPGVFAAGDVQDKYYRQAITSAGSGCMAALDAERFLE 311          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_CHLPN (Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.830e-20
Identity = 46/66 (69.70%), Postives = 55/66 (83.33%), Query Frame = -2
Query:  298 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYL 495
            H+P T FL GQL L   GYI+T+ GT+ TSVPGVFAAGDVQDK YRQAVT+AG+GC+AAL+AE +L
Sbjct:  245 HKPNTDFLGGQLTLDESGYIVTEKGTSKTSVPGVFAAGDVQDKYYRQAVTSAGSGCIAALDAERFL 310          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_CANGA (Thioredoxin reductase OS=Candida glabrata GN=TRR1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 2.830e-20
Identity = 45/69 (65.22%), Postives = 56/69 (81.16%), Query Frame = -2
Query:  289 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEI 495
            H PATK ++GQ++    GYI T PG++ TSVPGVFAAGDVQD KYRQA+T+AG+GCMA L+AE YL E+
Sbjct:  250 HTPATKIVEGQVETDETGYIKTIPGSSLTSVPGVFAAGDVQDSKYRQAITSAGSGCMAGLDAEKYLTEL 318          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_ASHGO (Thioredoxin reductase OS=Ashbya gossypii GN=TRR1 PE=3 SV=2)

HSP 1 Score: 97.4413 bits (241), Expect = 3.696e-20
Identity = 44/69 (63.77%), Postives = 57/69 (82.61%), Query Frame = -2
Query:  289 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEI 495
            H PAT+ + GQ+DL   GY+ T PG+T T+VPG+FAAGDVQD +YRQAVT+AG+GCMAAL+AE +L E+
Sbjct:  250 HTPATQLVAGQVDLDESGYVKTVPGSTLTNVPGLFAAGDVQDSRYRQAVTSAGSGCMAALDAEKFLSEL 318          
BLAST of DN617286 vs. ExPASy Swiss-Prot
Match: TRXB_KLULA (Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis GN=TRR1 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.827e-20
Identity = 44/69 (63.77%), Postives = 56/69 (81.16%), Query Frame = -2
Query:  289 HEPATKFLDGQLDLHSDGYIITKPGTTHTSVPGVFAAGDVQDKKYRQAVTAAGTGCMAALEAEHYLQEI 495
            H PAT  + GQ+DL   GY+ T PG+T T+VPGVFAAGDVQD +YRQA+T+AG+GCMAAL+AE Y+ E+
Sbjct:  280 HTPATNIVAGQVDLDEAGYVKTVPGSTLTNVPGVFAAGDVQDARYRQAITSAGSGCMAALDAEKYITEL 348          
The following BLAST results are available for this feature:
BLAST of DN617286 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 36
Match NameE-valueIdentityDescription
TRXB1_ARATH2.915e-3384.42Thioredoxin reductase 1 OS=Arabidopsis thaliana GN... [more]
TRXB2_ARATH3.807e-3385.71Thioredoxin reductase 2 OS=Arabidopsis thaliana GN... [more]
TRXB_NEUCR6.092e-2370.59Thioredoxin reductase OS=Neurospora crassa GN=cys-... [more]
TRXB_CHLMU4.366e-2167.65Thioredoxin reductase OS=Chlamydia muridarum GN=tr... [more]
TRXB_PENCH1.659e-2058.11Thioredoxin reductase OS=Penicillium chrysogenum G... [more]
TRXB_CHLTR2.167e-2067.16Thioredoxin reductase OS=Chlamydia trachomatis GN=... [more]
TRXB_CHLPN2.830e-2069.70Thioredoxin reductase OS=Chlamydia pneumoniae GN=t... [more]
TRXB_CANGA2.830e-2065.22Thioredoxin reductase OS=Candida glabrata GN=TRR1 ... [more]
TRXB_ASHGO3.696e-2063.77Thioredoxin reductase OS=Ashbya gossypii GN=TRR1 P... [more]
TRXB_KLULA4.827e-2063.77Thioredoxin reductase, mitochondrial OS=Kluyveromy... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A03_f Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617286 ID=DN617286|Name=DN617286|organism=Citrus sinensis|type=EST|length=496bp
TAATATATGTCTTAAAAAATTCCATCCAACAATTACATTCTAAAATGCAG
CACTAATACCAACTTAAAACAAATTCCTTATCCAATTAGTTTTTCCAACC
AACTATTGGAAGCCAATAAATAAATCACTAAGACAGTACTGATTCATCAC
TTGAATTGGTCGAGAAAAAGCCTTCTTCATTCAGAGGTAGATTTAGATCA
AGTTTGCATGTAGACTATTCTGCTTTCATCATATCCCAGCCCTGCCATTA
TCCTACAGTGAAGATTCACTCTTATCCTCCTGAGATCCTATCTCTTGCAA
GTAATGCTCAGCTTCCAAGGCTGCCATGCACCCAGTGCCGGCGGCGGTAA
CAGCCTGCCTGTACTTCTTATCCTGAACATCTCCAGCAGCAAACACTCCA
GGGACACTAGTGTGTGTAGTCCCAGGTTTGGTAATAATATAACCATCAGA
ATGCAGGTCCAACTGACCATCCAAAAACTTAGTAGCAGGCTCGTGT
back to top