DN617283

Overview
NameDN617283
Unique NameDN617283
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length482
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11228 contig Csv1_Contig11228:20..501. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.918e-74
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 275.789 bits (704), Expect = 6.918e-74
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.918e-74
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 273.863 bits (699), Expect = 2.629e-73
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 4.484e-73
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 4.484e-73
Identity = 134/135 (99.26%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 7.648e-73
Identity = 133/135 (98.52%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 271.937 bits (694), Expect = 9.989e-73
Identity = 133/135 (98.52%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.305e-72
Identity = 133/135 (98.52%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
BLAST of DN617283 vs. ExPASy Swiss-Prot
Match: EF1A2_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.305e-72
Identity = 133/135 (98.52%), Postives = 134/135 (99.26%), Query Frame = 1
Query:   76 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 480
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTRE 135          
The following BLAST results are available for this feature:
BLAST of DN617283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_WHEAT6.918e-74100.00Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_ORYSJ6.918e-74100.00Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_MAIZE6.918e-74100.00Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_MANES2.629e-7399.26Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_TOBAC4.484e-7399.26Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH4.484e-7399.26Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A_VICFA7.648e-7398.52Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]
EF1A_SOYBN9.989e-7398.52Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_SOLLC1.305e-7298.52Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A2_DAUCA1.305e-7298.52Elongation factor 1-alpha OS=Daucus carota PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A01_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617283 ID=DN617283|Name=DN617283|organism=Citrus sinensis|type=EST|length=482bp
CAATTTCCGAAGGGCGGCGAGAGAGAACCATTTTCGCGAATATCATTTTA
ATAAGGTTTTTTCTAGATTTGCCTAATGGGTAAGGAGAAGACTCACATCA
ACATTGTGGTCATCGGCCATGTCGACTCTGGAAAGTCGACCACCACCGGA
CACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATCGAGAGGTT
CGAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAATACGCCTGGG
TGCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCATTGATATT
GCCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTCATTGATGC
TCCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTACCTCACAGG
CTGACTGTGCTGTCCTCATCATTGACTCTACCACTGGTGGTTTTGAAGCT
GGTATCTCCAAGGATGGTCAGACTCGTGAGCA
back to top