DN135275

Overview
NameDN135275
Unique NameDN135275
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135275_ssr626 microsatellite DN135275_ssr626:626..643. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6849 contig Csv1_Contig6849:246..930. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP17_ARATH (17.4 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.4A PE=1 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 8.189e-56
Identity = 104/158 (65.82%), Postives = 124/158 (78.48%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSL+PS FGGRRTNVFDPFSLDVWDPF+GFL+  LTNAP  A++ + F NA++DW+ETP+AHVFKAD+PGL+          G ILQISGERS E EEK+D WHRVERSSGKF+RRFRLP+NAKVE+VKASMENGVL+VT            +++ISG
Sbjct:    1 MSLVPSFFGGRRTNVFDPFSLDVWDPFEGFLTPGLTNAP--AKDVAAFTNAKVDWRETPEAHVFKADVPGLKKEEVKVEVEDGNILQISGERSSENEEKSDTWHRVERSSGKFMRRFRLPENAKVEEVKASMENGVLSVTVPKVQESKPEVKSVDISG 156          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HS181_ARATH (18.1 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 9.054e-55
Identity = 107/160 (66.88%), Postives = 125/160 (78.12%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFL--SSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPSIFGGRR+NVFDPFS D+WDPF+GF   SSAL NA S+AR+ + F NAR+DWKETP+AHVFKADLPGL+            +LQISGERSKE EEKNDKWHRVER+SGKF+RRFRLP+NAK+E+VKA+MENGVLTV             +I+ISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSQDLWDPFEGFFTPSSALANA-STARDVAAFTNARVDWKETPEAHVFKADLPGLKKEEVKVEVEDKNVLQISGERSKENEEKNDKWHRVERASGKFMRRFRLPENAKMEEVKATMENGVLTVVVPKAPEKKPQVKSIDISG 159          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HS17C_ARATH (17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 9.054e-55
Identity = 108/159 (67.92%), Postives = 124/159 (77.99%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLS-SALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPSIFGGRRTNVFDPFSLDV+DPF+GFL+ S L NAP  A + + F NA++DW+ETP+AHVFKADLPGLR          G ILQISGERS E EEKNDKWHRVERSSGKF RRFRLP+NAK+E++KASMENGVL+VT            +I+ISG
Sbjct:    1 MSLIPSIFGGRRTNVFDPFSLDVFDPFEGFLTPSGLANAP--AMDVAAFTNAKVDWRETPEAHVFKADLPGLRKEEVKVEVEDGNILQISGERSNENEEKNDKWHRVERSSGKFTRRFRLPENAKMEEIKASMENGVLSVTVPKVPEKKPEVKSIDISG 157          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP11_DAUCA (17.8 kDa class I heat shock protein OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.107e-52
Identity = 102/158 (64.56%), Postives = 119/158 (75.32%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MS+IPS FGGRR+NVFDPFSLDVWDPF  F     ++A    +ET+ F N  IDWKETPQAHVFKADLPGL+          G++LQISGER+KE+EEKNDKWHRVERSSGKFLRRFRLP+NAKV++VKA+M NGV+TVT            AI+ISG
Sbjct:    1 MSIIPSFFGGRRSNVFDPFSLDVWDPFKDF-PLVTSSASEFGKETAAFVNTHIDWKETPQAHVFKADLPGLKKEEVKVELEEGKVLQISGERNKEKEEKNDKWHRVERSSGKFLRRFRLPENAKVDEVKAAMANGVVTVTVPKVEIKKPEVKAIDISG 157          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP16_SOYBN (18.5 kDa class I heat shock protein OS=Glycine max GN=HSP18.5-C PE=3 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 5.493e-52
Identity = 105/163 (64.42%), Postives = 120/163 (73.62%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGF-----LSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIP+ FGGRR NVFDPFSLDVWDPF  F     LSSA  + P  +RE S F + R+DWKETP+AHVFKAD+PGL+           ++LQISGER+ E+E+KND WHRVERSSGKF+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPNFFGGRRNNVFDPFSLDVWDPFKDFPFPNTLSSA--SFPEFSRENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDKVLQISGERNVEKEDKNDTWHRVERSSGKFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 161          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP13_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-M PE=3 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 4.650e-51
Identity = 103/159 (64.78%), Postives = 118/159 (74.21%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPSIFGGRR+NVFDPFSLDVWDPF  F      + P+S + E S F N R+DWKETP+AHVF+AD+PGL+           R+LQISGER+ E+E+KND WHRVERSSG F+RRFRLP+NAKVEQVKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPSIFGGRRSNVFDPFSLDVWDPFKDF------HFPTSLSAENSAFVNTRVDWKETPEAHVFEADIPGLKKEEVKVQIEDDRVLQISGERNLEKEDKNDTWHRVERSSGNFMRRFRLPENAKVEQVKASMENGVLTVTVPKEEVKKPDVKAIEISG 153          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP12_MEDSA (18.2 kDa class I heat shock protein OS=Medicago sativa GN=HSP18.2 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 6.073e-51
Identity = 98/158 (62.03%), Postives = 117/158 (74.05%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPS FGGRR+NVFDPFSLDVWDPF  F  +    + S  RE S F + R+DWKETP+AHVFKADLPG++           R+LQISGERS E+E+KND+WHR+ERSSGKF+RRFRLP+NAK++QVKA+MENGVLTVT             I+ISG
Sbjct:    1 MSLIPSFFGGRRSNVFDPFSLDVWDPFKDFPFNNSALSASFPRENSAFVSTRVDWKETPEAHVFKADLPGMKKEEVKVEIEDDRVLQISGERSVEKEDKNDQWHRLERSSGKFMRRFRLPENAKMDQVKAAMENGVLTVTVPKEEVKKPEVKTIDISG 158          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP11_PEA (18.1 kDa class I heat shock protein OS=Pisum sativum GN=HSP18.1 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 1.036e-50
Identity = 100/158 (63.29%), Postives = 116/158 (73.42%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPS F GRR+NVFDPFSLDVWDP   F  S  + + S  RE   F + R+DWKETP+AHVFKADLPGL+           R+LQISGERS E+E+KND+WHRVERSSGKFLRRFRLP+NAK+++VKASMENGVLTVT            +IEISG
Sbjct:    1 MSLIPSFFSGRRSNVFDPFSLDVWDPLKDFPFSNSSPSASFPRENPAFVSTRVDWKETPEAHVFKADLPGLKKEEVKVEVEDDRVLQISGERSVEKEDKNDEWHRVERSSGKFLRRFRLPENAKMDKVKASMENGVLTVTVPKEEIKKAEVKSIEISG 158          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP11_SOYBN (17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 8.769e-50
Identity = 101/159 (63.52%), Postives = 117/159 (73.58%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSS-ARETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIPS FGGRR++VFDPFSLDVWDPF  F        PSS + E S F + R+DWKETP+AHVFKAD+PGL+          GR+LQISGER+ E+E+KND WHRVERSSGK +RRFRLP+NAKV+QVKASMENGVLTVT            AI+ISG
Sbjct:    1 MSLIPSFFGGRRSSVFDPFSLDVWDPFKDF------PFPSSLSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKLEIQDGRVLQISGERNVEKEDKNDTWHRVERSSGKLVRRFRLPENAKVDQVKASMENGVLTVTVPKEEIKKPDVKAIDISG 153          
BLAST of DN135275 vs. ExPASy Swiss-Prot
Match: HSP14_SOYBN (17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 4.352e-49
Identity = 99/160 (61.88%), Postives = 115/160 (71.88%), Query Frame = 3
Query:   78 MSLIPSIFGGRRTNVFDPFSLDVWDPFDGFLSSALTNAPSSA--RETSQFANARIDWKETPQAHVFKADLPGLRXXXXXXXXXXGRILQISGERSKEQEEKNDKWHRVERSSGKFLRRFRLPDNAKVEQVKASMENGVLTVTXXXXXXXXXXXXAIEISG 551
            MSLIP  FGGRR+NVFDPFSLD+WDPF  F      + P+S+   E S F + R+DWKETP+AHVFKAD+PGL+           R+LQISGER+ E+E+KND WHRVERSSGKF RRFRLP+NAKV +VKASMENGVLTVT            AIEISG
Sbjct:    1 MSLIPGFFGGRRSNVFDPFSLDMWDPFKDF------HVPTSSVSAENSAFVSTRVDWKETPEAHVFKADIPGLKKEEVKVQIEDDRVLQISGERNVEKEDKNDTWHRVERSSGKFTRRFRLPENAKVNEVKASMENGVLTVTVPKEEVKKPDVKAIEISG 154          
The following BLAST results are available for this feature:
BLAST of DN135275 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
HSP17_ARATH8.189e-5665.8217.4 kDa class I heat shock protein OS=Arabidopsis... [more]
HS181_ARATH9.054e-5566.8818.1 kDa class I heat shock protein OS=Arabidopsis... [more]
HS17C_ARATH9.054e-5567.9217.6 kDa class I heat shock protein 3 OS=Arabidops... [more]
HSP11_DAUCA1.107e-5264.5617.8 kDa class I heat shock protein OS=Daucus caro... [more]
HSP16_SOYBN5.493e-5264.4218.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP13_SOYBN4.650e-5164.7817.5 kDa class I heat shock protein OS=Glycine max... [more]
HSP12_MEDSA6.073e-5162.0318.2 kDa class I heat shock protein OS=Medicago sa... [more]
HSP11_PEA1.036e-5063.2918.1 kDa class I heat shock protein OS=Pisum sativ... [more]
HSP11_SOYBN8.769e-5063.5217.3 kDa class I heat shock protein OS=Glycine max... [more]
HSP14_SOYBN4.352e-4961.8817.5 kDa class I heat shock protein OS=Glycine max... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08h08 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08h08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135275 ID=DN135275|Name=DN135275|organism=Citrus sinensis|type=EST|length=684bp
CGGCCGGGATCTTCGAATTGATTGATCAAACACTTCTGAAGTTGTTGAGC
ATTTAATTAGCGCCCCAGTTTGCCATAATGTCACTCATTCCAAGCATCTT
CGGTGGCCGAAGAACCAACGTGTTCGATCCATTTTCATTAGATGTATGGG
ATCCTTTCGACGGGTTCTTGTCCTCTGCCCTTACCAACGCGCCGTCTTCG
GCTAGGGAAACATCCCAATTCGCCAATGCAAGAATTGACTGGAAAGAGAC
TCCTCAGGCTCATGTATTCAAGGCTGATCTTCCAGGGCTGAGGAAAGAAG
AAGTGAAAGTTGAGGTTGAAGAGGGCAGGATTCTGCAGATAAGCGGGGAG
AGGAGCAAGGAGCAGGAAGAGAAGAATGACAAGTGGCATCGCGTCGAGAG
GAGCAGTGGCAAGTTCCTGAGGAGGTTCAGGTTGCCCGACAATGCTAAGG
TGGAGCAGGTTAAGGCCAGCATGGAGAATGGTGTGCTCACAGTGACCGTT
CCTAAACAGGAGGAGAAGAAACCTGAAGTTAAGGCCATTGAGATCTCTGG
CTAAGTGATAAGTGTAAATGTTTTCAAGATTGTGTCTTTGGTTTGCTAAT
AAATTTGGTACGAAAGCAAAGCCCTTGTGTGTGTGTGTGTGTGCTTGCAA
GAGCTTCCCTTCCCCCCCTGTTTAATTCGATGTG
back to top