DN135270

Overview
NameDN135270
Unique NameDN135270
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length687
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1201 contig Csv1_Contig1201:244..931. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: YOOF_SCHPO (Uncharacterized hydroxylase C887.15c OS=Schizosaccharomyces pombe GN=SPBC887.15c PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.600e-43
Identity = 95/233 (40.77%), Postives = 130/233 (55.79%), Query Frame = 2
Query:   80 PILVYWLYSGL-----YVVLGSFDKLDNYRLHSRIDEDEKNLVSKGDVVKGVLLQQFFQAIVAILLFAVTGNGAGA-EANQ----------------QSSP---------IAIARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIKTVDDHCGLWLPGNLFHVFFXXNTAYHDIHHQLY 685
            P+++YW+ S       Y+ L  F+K   YR+H   +   +N V +  VVK VL QQ  + +V I L    G      EA Q                Q +P         I  A Q+  A  ++D+WQYF HRY+H+NK LY  IH+ HHRL VPYA GALYNHP EGL+ DT G  +++L +G+SP+ ++ FF+ +T+KTVDDHCG   P +   +FF  N  YHD+HHQ Y
Sbjct:   21 PVIIYWVASAFFGFLHYIELPVFEK---YRIHPPEEIARRNRVPQMAVVKAVLFQQLCEVVVGIALAMFEGYPEPIDEAKQMLRYEAFFSKNLPALLQVAPFAPKLAYNFIVPAFQYFFAFFIIDSWQYFWHRYLHYNKKLYNMIHAHHHRLQVPYAMGALYNHPFEGLILDTFGAGVAYLAAGLSPQQAVIFFTLSTLKTVDDHCGYVFPYDPLQMFFANNARYHDLHHQPY 250          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: SUR2_YEAST (Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae GN=SUR2 PE=1 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.975e-41
Identity = 88/232 (37.93%), Postives = 128/232 (55.17%), Query Frame = 2
Query:   50 ISDELLGTFVPILVYWLYSGLYVVLGSFDKLDNYRLHSRIDEDEKNLVSKGDVVKGVLLQQFFQAIVAILL-----FAVTGNGAGAEANQQSSPIAI---------------ARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIKTVDDHCGLWLPGNLFHVFFXXNTAYHDIHHQLY 685
            +SD +L    P++ YW  SG++ V+ +F   + YR+H   +  ++N  S+  V   V+LQ   Q IV ++        +TG    A    ++    I               A +     L +DTWQYF+HR MH NK LY+  HS+HH L VPYA+GAL+N+P+EG L DT+G  ++  ++ ++ R  I  F+FAT+KTVDDHCG  LP + F   F  N  YHDIHHQ +
Sbjct:   46 MSDGVLALVAPVVAYWALSGIFHVIDTFHLAEKYRIHPSEEVAKRNKASRMHVFLEVILQHIIQTIVGLIFMHFEPIYMTGFEENAMWKLRADLPRIIPDAAIYYGYMYGMSALKIFAGFLFVDTWQYFLHRLMHMNKTLYKWFHSVHHELYVPYAYGALFNNPVEGFLLDTLGTGIAMTLTHLTHREQIILFTFATMKTVDDHCGYALPLDPFQWLFPNNAVYHDIHHQQF 277          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_PIG (C-4 methylsterol oxidase OS=Sus scrofa GN=SC4MOL PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.822e-14
Identity = 44/124 (35.48%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  317 IAIARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFAT---IKTVDDHCGLWLPGNLFHVF-FXXNTAYHDIHH 676
            IA+AR F  A+ + DTW YF+HR +HH + +Y++IH +HH    P+   A Y HP+E L+   +G      +  +   V I  +++ T   I+T+D H G  +P N  H+  F   + +HD HH
Sbjct:  137 IALARCFGCAV-IEDTWHYFLHRLLHHKR-IYKYIHKIHHEFQAPFGMEAEYAHPLETLI---LGTGFFIGIMLLCDHV-ILLWAWVTVRLIETIDVHSGYDIPLNPLHLIPFYAGSRHHDFHH 254          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_DANRE (C-4 methylsterol oxidase OS=Danio rerio GN=sc4mol PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.882e-13
Identity = 43/125 (34.40%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  314 PIAIARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFAT---IKTVDDHCGLWLPGNLFHVF-FXXNTAYHDIHH 676
            P  +A+ F  A+ + DTW YF+HR +HH + +Y++IH +HH    P+   A Y HP+E L    I GA  F+ + +     I  +++ T   ++T+D H G  +P N  H+  F     +HD HH
Sbjct:  136 PFLLAQCFGCAV-IEDTWHYFLHRALHHRR-IYKYIHKVHHDFTSPFGMQAEYAHPLETL----ILGAGFFIGTMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHH 254          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: CE004_MACFA (Uncharacterized protein C5orf4 homolog OS=Macaca fascicularis GN=QccE-20373 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.129e-12
Identity = 54/204 (26.47%), Postives = 91/204 (44.61%), Query Frame = 2
Query:   77 VPILVYWLYSGLYVVLGSFDKLDNYRLHSRIDEDEKNLVSKGDVVKGVLLQQFFQAIVA--ILLFAVTGNGAGAEANQQSSPIA--IARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIKTVDDHCGLWLPGNLFHVFFXXNTAYHDIHH 676
            VP L +W ++GL +V+ +  K  N+    RI   +   V    + + +    F Q +V+  +++F         +  ++  P       +  I  L+ +   Y+ HR +HH  F Y+ IH  HH    P    +LY HPIE ++++ +   +  LV G        +FS A I T   HCG       +H+ F  +  +HD HH
Sbjct:   86 VPCLFFWSFNGLLLVVDTTGK-PNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMVSFPMVVFLYPFLKWWGDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTF-YKKIHKKHHEWTAPIGVISLYAHPIEHVVSNMLPAIVGPLVMGSHLSSITMWFSLALIITTISHCG-------YHLPFLPSPEFHDYHH 280          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_MACFA (C-4 methylsterol oxidase OS=Macaca fascicularis GN=SC4MOL PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 42/122 (34.43%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  323 IARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIK---TVDDHCGLWLPGNLFHVF-FXXNTAYHDIHH 676
            +AR F  A+ + DTW YFMHR +HH + +Y++IH +HH    P+   A Y HP+E L+   +G      +  +   V I  +++ TI+   T+D H G  +P N  ++  F   + +HD HH
Sbjct:  139 LARCFGCAV-IEDTWHYFMHRLLHHKR-IYKYIHKVHHEFQAPFGMEAEYAHPLETLI---LGTGFFIGIVLLCDHV-ILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHH 254          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_PONAB (C-4 methylsterol oxidase OS=Pongo abelii GN=SC4MOL PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.606e-12
Identity = 41/122 (33.61%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  323 IARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIK---TVDDHCGLWLPGNLFHVF-FXXNTAYHDIHH 676
            +AR F  A+ + DTW YF+HR +HH + +Y++IH +HH    P+   A Y HP+E L+   +G      +  +   V I  +++ TI+   T+D H G  +P N  ++  F   + +HD HH
Sbjct:  139 LARCFGCAV-IEDTWHYFLHRLLHHKR-IYKYIHKVHHEFQAPFGMEAEYAHPLETLI---LGTGFFIGIVLLCDHV-ILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHH 254          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_HUMAN (C-4 methylsterol oxidase OS=Homo sapiens GN=SC4MOL PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.606e-12
Identity = 41/122 (33.61%), Postives = 67/122 (54.92%), Query Frame = 2
Query:  323 IARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIK---TVDDHCGLWLPGNLFHVF-FXXNTAYHDIHH 676
            +AR F  A+ + DTW YF+HR +HH + +Y++IH +HH    P+   A Y HP+E L+   +G      +  +   V I  +++ TI+   T+D H G  +P N  ++  F   + +HD HH
Sbjct:  139 LARCFGCAV-IEDTWHYFLHRLLHHKR-IYKYIHKVHHEFQAPFGMEAEYAHPLETLI---LGTGFFIGIVLLCDHV-ILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHH 254          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: CE004_HUMAN (Uncharacterized protein C5orf4 OS=Homo sapiens GN=C5orf4 PE=1 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.321e-12
Identity = 53/204 (25.98%), Postives = 90/204 (44.12%), Query Frame = 2
Query:   77 VPILVYWLYSGLYVVLGSFDKLDNYRLHSRIDEDEKNLVSKGDVVKGVLLQQFFQAIVA--ILLFAVTGNGAGAEANQQSSPIA--IARQFVIAMLVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIKTVDDHCGLWLPGNLFHVFFXXNTAYHDIHH 676
            VP L +W ++GL +V+ +  K  N+    RI   +   V    + + +    F Q +++  +++F         +  ++  P       +  I  L+ +   Y+ HR +HH  F Y+ IH  HH    P    +LY HPIE  +++ +   +  LV G        +FS A I T   HCG       +H+ F  +  +HD HH
Sbjct:   86 VPCLFFWSFNGLLLVVDTTGK-PNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTF-YKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCG-------YHLPFLPSPEFHDYHH 280          
BLAST of DN135270 vs. ExPASy Swiss-Prot
Match: ERG25_RAT (C-4 methylsterol oxidase OS=Rattus norvegicus GN=Sc4mol PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.249e-11
Identity = 35/110 (31.82%), Postives = 60/110 (54.55%), Query Frame = 2
Query:  350 LVMDTWQYFMHRYMHHNKFLYRHIHSLHHRLVVPYAFGALYNHPIEGLLNDTIGGALSFLVSGMSPRVSIFFFSFATIKTVDDHCGLWLPGN-LFHVFFXXNTAYHDIHH 676
            ++ DTW YF+HR +HH + +Y++IH +HH    P+   A Y HP+E L+  T G  +  ++      +   + +   ++T+D H G  +P N L ++ F     +HD HH
Sbjct:  147 VIEDTWHYFLHRLLHHKR-IYKYIHKVHHEFQAPFGIEAEYAHPLETLILGT-GFFIGIVLLCDHVILLWAWVTMRLLETIDVHSGYDIPLNPLNYIPFYTGARHHDFHH 254          
The following BLAST results are available for this feature:
BLAST of DN135270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
YOOF_SCHPO3.600e-4340.77Uncharacterized hydroxylase C887.15c OS=Schizosacc... [more]
SUR2_YEAST1.975e-4137.93Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces ... [more]
ERG25_PIG7.822e-1435.48C-4 methylsterol oxidase OS=Sus scrofa GN=SC4MOL P... [more]
ERG25_DANRE3.882e-1334.40C-4 methylsterol oxidase OS=Danio rerio GN=sc4mol ... [more]
CE004_MACFA1.129e-1226.47Uncharacterized protein C5orf4 homolog OS=Macaca f... [more]
ERG25_MACFA2.516e-1234.43C-4 methylsterol oxidase OS=Macaca fascicularis GN... [more]
ERG25_PONAB5.606e-1233.61C-4 methylsterol oxidase OS=Pongo abelii GN=SC4MOL... [more]
ERG25_HUMAN5.606e-1233.61C-4 methylsterol oxidase OS=Homo sapiens GN=SC4MOL... [more]
CE004_HUMAN7.321e-1225.98Uncharacterized protein C5orf4 OS=Homo sapiens GN=... [more]
ERG25_RAT1.249e-1131.82C-4 methylsterol oxidase OS=Rattus norvegicus GN=S... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca08h02 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08h02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135270 ID=DN135270|Name=DN135270|organism=Citrus sinensis|type=EST|length=687bp
CCGGGGGAGCGAGTGTCCCGTTGGCGATCGTCACACGATGGCGTTTACGA
TTTCCGACGAATTGTTGGGCACTTTCGTCCCAATTTTAGTCTATTGGTTG
TATTCAGGATTATACGTCGTTCTTGGATCTTTTGATAAGCTTGATAATTA
TAGATTGCATTCGAGAATTGACGAGGACGAGAAAAATTTGGTCTCTAAGG
GCGATGTCGTTAAAGGCGTTCTCCTTCAGCAATTTTTTCAGGCTATTGTT
GCAATTCTCTTGTTTGCGGTGACAGGAAATGGTGCTGGGGCAGAAGCCAA
TCAACAGTCTTCCCCAATTGCTATAGCTCGGCAGTTTGTTATAGCAATGT
TGGTTATGGATACATGGCAGTATTTTATGCACAGGTACATGCACCACAAC
AAGTTTTTGTATCGACACATCCATTCTCTACATCACCGCCTTGTTGTCCC
CTATGCATTTGGAGCTTTGTATAATCACCCCATTGAGGGGCTTCTTAATG
ACACAATTGGCGGAGCCTTATCCTTTCTCGTTTCCGGTATGTCTCCCCGA
GTCTCCATCTTCTTCTTTTCCTTTGCCACCATCAAAACAGTGGATGACCA
CTGTGGATTATGGCTTCCTGGAAACCTCTTCCACGTGTTCTTCAANNACA
ACACTGCCTATCATGATATCCACCATCAACTTTATGG
back to top