DN135269

Overview
NameDN135269
Unique NameDN135269
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length513
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135269_ssr5 microsatellite DN135269_ssr5:5..19. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2614 contig Csv1_Contig2614:125..638. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 6.493e-23
Identity = 44/66 (66.67%), Postives = 55/66 (83.33%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +SD+CGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.655e-18
Identity = 38/64 (59.38%), Postives = 48/64 (75.00%), Query Frame = 2
Query:   92 SCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 283
            +CGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.655e-18
Identity = 43/65 (66.15%), Postives = 49/65 (75.38%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 277
            +SD CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 2.642e-16
Identity = 37/65 (56.92%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 277
            +S  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 4.507e-16
Identity = 38/66 (57.58%), Postives = 46/66 (69.70%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +S  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.713e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +SD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.713e-15
Identity = 35/66 (53.03%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +SD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.603e-13
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +SD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DN135269 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 6.092e-13
Identity = 31/66 (46.97%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   83 VSDSCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 280
            +SD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DN135269 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA6.493e-2366.67Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC1.655e-1859.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE1.655e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV2.642e-1656.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO4.507e-1657.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ1.713e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI1.713e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ1.603e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI6.092e-1346.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08h01 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08h01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135269 ID=DN135269|Name=DN135269|organism=Citrus sinensis|type=EST|length=513bp
TCACAGCAAAGCAAAGCAAGTTTCGTACAATAAAGAGCCCTCTATTTCCA
GTTTTAAATTCCAAGTTCTAAGCTCAATCAACGTGTCGGACTCCTGCGGC
AACTGCGACTGCGCTGACAGGAGCCAGTGTGTGAAGAAGGGAAGCAGCTA
TGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCACCGTTGTTG
TCATGGACGTTCAGGCTGCTGAGACTGAAGGTAACTGCAAGTGCGGCCCC
ACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTAATAAGCAAACAC
ATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTAAATATTGTGGGGGTT
AAGAATAATGTAAGGGTGATTAAAAAAAAAGAAAAATTCTCTACTTCGTT
TTTATGATGGTCTACTACTAGTGTGCGGAGTGATGTGCGTGTTGTGTCAC
CCATCACTCGTAATGTTTTGTGTTTCCTTCTTCANAATNNNGTAATATAT
GGCCATGGCCCTG
back to top