DN135241

Overview
NameDN135241
Unique NameDN135241
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length604
Libraries
Library NameType
Mature Juice Sac from Navel Orange in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135241_ssr14 microsatellite DN135241_ssr14:14..28. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2614 contig Csv1_Contig2614:116..720. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 3.266e-23
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSDTCGNCDCAD++QC KKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.422e-18
Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = 2
Query:  101 TCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 292
            TCGNCDC D+SQC KKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.163e-18
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 286
            MSD CGNCDCAD SQC KKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.736e-16
Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 286
            MS  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.613e-16
Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MS  C NCDCAD +QC KKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD CGNCDCAD+SQC KKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 3.273e-15
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD CGNCDCAD+SQC KKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.064e-13
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD CGNCDCAD+SQC KKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of DN135241 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.164e-12
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 MSDTCGNCDCADRSQCAKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 289
            MSD CG+CDCAD+SQC KKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of DN135241 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA3.266e-2368.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC2.422e-1859.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE3.163e-1866.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV1.736e-1658.46Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO8.613e-1657.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ3.273e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI3.273e-1553.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ3.064e-1348.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI1.164e-1246.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca08d07 Mature Juice Sac from Navel Orange in Vulnus5 vector Citrus sinensis cDNA clone wca08d07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135241 ID=DN135241|Name=DN135241|organism=Citrus sinensis|type=EST|length=604bp
CGGCCGGGGANNNAGCAAAGCAAAGCAAGTTTCGTACAATAAAGAGCCCT
CTATTTCCAGTTTTAAATTCCAAGTTCTAAGCTCAATCAACATGTCGGAC
ACCTGCGGCAACTGCGACTGCGCTGACAGGAGCCAGTGTGCGAAGAAGGG
AAGCAGCTATGCTGCTGACTTCGTCGAGACTGACTTGAGCTTTGTCAGCA
CCGTTGTTGTCATGGACGTTCAGGCTGCTGAGACTGAAGGTAACTGCAAG
TGCGGCCCCACCTGCGCTTGTGTGAACTGCACTTGTGGTAGTCACTAATA
AGCAAACACATGCAGCAAAAAATAAGAAGCTGCAAGTGTGCCTAAATATT
GTGGGGGTTAAGAATAATGTAAGGGTGATTAAAAAAAAAGAAAAATTCTC
TACTTCGTTTTTATGATGGTCTACTACTAGTGTGTGGAGTGATGTGCGCG
TTGTGTCACCCATCACTCGTAATGTTTTGTGTTTCCTTCTTCATAATCAT
GTAATATATGGCCATGGCCATGACCGTGGCCTTGTGTGGTTTAATTTTAA
TGTATTATTGTTAGTCTACAGCGNAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA
back to top